This work is licensed under a Creative Commons Attribution 4.0 International License.
Melittin (12-26)[A4L]-AGP-Thanatin
General Information
DRACP ID DRACP03776
Peptide Name Melittin (12-26)[A4L]-AGP-Thanatin
Sequence GLPLLISWIKRKRQQAGPGSKKPVPIIYCNRRTGKCQRM
Sequence Length 39
UniProt ID P55788
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C198H338N64O48S3
Absent amino acids DEFH
Common amino acids KR
Mass 515742
Pl 12.04
Basic residues 10
Acidic residues 0
Hydrophobic residues 10
Net charge 10
Boman Index -8383
Hydrophobicity -67.18
Aliphatic Index 80
Half Life
Mammalian: 1 hour
Yeast: 2 min
E.coli: 2 min
Extinction Coefficient cystines 7115
Absorbance 280nm 187.24
Polar residues 11
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 30701481
Title Design and activity study of a melittin-thanatin hybrid peptide
Doi Not available
Year 2019
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 12528
This work is licensed under a Creative Commons Attribution 4.0 International License.