This work is licensed under a Creative Commons Attribution 4.0 International License.
Acipensin 1, Ac1
General Information
DRACP ID DRACP03798
Peptide Name Acipensin 1, Ac1
Sequence SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVY
Sequence Length 50
UniProt ID C0HJQ3
PubChem CID Not available
Origin Animalia
Type Native peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Acetylation
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C229H388N84O61
Absent amino acids CDEIMW
Common amino acids GR
Mass 616830
Pl 12.74
Basic residues 14
Acidic residues 0
Hydrophobic residues 15
Net charge 14
Boman Index -13008
Hydrophobicity -77.6
Aliphatic Index 60.6
Half Life
Mammalian: 1.1 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 2980
Absorbance 280nm 60.82
Polar residues 17
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 25558400
Title Acipensins - Novel Antimicrobial Peptides from Leukocytes of the Russian Sturgeon Acipenser gueldenstaedtii
Doi Not available
Year 2014
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 12669
This work is licensed under a Creative Commons Attribution 4.0 International License.