This work is licensed under a Creative Commons Attribution 4.0 International License.
Acipensin 2, Ac2
General Information
DRACP ID DRACP03799
Peptide Name Acipensin 2, Ac2
Sequence SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLR
Sequence Length 35
UniProt ID C0HJQ3
PubChem CID Not available
Origin Animalia
Type Native peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Acetylation
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C160H283N63O42
Absent amino acids CDEIMNWY
Common amino acids R
Mass 436802
Pl 13.29
Basic residues 12
Acidic residues 0
Hydrophobic residues 10
Net charge 12
Boman Index -11348
Hydrophobicity -90.86
Aliphatic Index 61.43
Half Life
Mammalian: 1.9 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 0
Absorbance 280nm 0
Polar residues 11
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 25558400
Title Acipensins - Novel Antimicrobial Peptides from Leukocytes of the Russian Sturgeon Acipenser gueldenstaedtii
Doi Not available
Year 2014
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 12670
This work is licensed under a Creative Commons Attribution 4.0 International License.