This work is licensed under a Creative Commons Attribution 4.0 International License.
Similar to Plectasin acc. no. Q53I06, Po Defensin-like peptide
General Information
DRACP ID DRACP03819
Peptide Name Similar to Plectasin acc. no. Q53I06, Po Defensin-like peptide
Sequence GFGCNGPWDEDDMKCHNHCKSIKGYKGGYCASAGFVCKCY
Sequence Length 40
UniProt ID U4LWE8
PubChem CID Not available
Origin Synthetic
Type Native peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C188H272N52O56S7
Absent amino acids LQRT
Common amino acids G
Mass 507681
Pl 7.78
Basic residues 7
Acidic residues 4
Hydrophobic residues 7
Net charge 3
Boman Index -5306
Hydrophobicity -57.25
Aliphatic Index 22
Half Life
Mammalian: 2.8 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 10345
Absorbance 280nm 265.26
Polar residues 20
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 35630326
Title In Vitro Pharmacodynamics and Bactericidal Mechanism of Fungal Defensin-Derived Peptides NZX and P2 against Streptococcus agalactiae
Doi Not available
Year 2022
Literature 2
Pubmed ID 33534018
Title A recombinant fungal defensin-like peptide-P2 combats Streptococcus dysgalactiae and biofilms
Doi Not available
Year 2021
Literature 3
Pubmed ID 31025073
Title A recombinant fungal defensin-like peptide-P2 combats multidrug-resistant Staphylococcus aureus and biofilms
Doi Not available
Year 2019
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 13059
This work is licensed under a Creative Commons Attribution 4.0 International License.