Cm-CATH2

General Information


DRACP ID  DRACP03824

Peptide Name   Cm-CATH2

Sequence  RRSRFGRFFKKVRKQLGRVLRHSRITVGGRMRF

Sequence Length  33

UniProt ID  M7BBJ0 

PubChem CID  Not available

Origin  Animalia

Type  Native peptide

Classification

  

Active ACP



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

Nature  Anticancer; Antibacterial; Antifungal



Structure Information


PDB ID  Not available

Predicted Structure  Not available

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C181H307N69O38S

Absent amino acids  ACDENPWY

Common amino acids  R

Mass  466084

Pl  13.46

Basic residues  14

Acidic residues  0

Hydrophobic residues  10

Net charge  14

Boman Index  -14051

Hydrophobicity  -89.39

Aliphatic Index  61.82

Half Life 
  Mammalian: 1.9 hour
  Yeast: >20 hour
  E.coli: >10 hour

Extinction Coefficient cystines  0

Absorbance 280nm  0

Polar residues  7

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 31121185

Title  Diversity, immunoregulatory action and structure-activity relationship of green sea turtle cathelicidins

Doi Not available

Year  0

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  13254

DRACP is developed by Dr.Zheng's team.