This work is licensed under a Creative Commons Attribution 4.0 International License.
Defensin-like peptide 2, DLP2
General Information
DRACP ID DRACP03835
Peptide Name Defensin-like peptide 2, DLP2
Sequence ATCDLLSPFKVGHAACALHCIAMGRRGGWCDGRAVCNCRR
Sequence Length 40
UniProt ID W5U604
PubChem CID Not available
Origin Animalia
Type Native peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C177H288N62O48S7
Absent amino acids EQY
Common amino acids AC
Mass 497291
Pl 8.64
Basic residues 8
Acidic residues 2
Hydrophobic residues 14
Net charge 6
Boman Index -6086
Hydrophobicity 13.75
Aliphatic Index 68.5
Half Life
Mammalian: 100 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 5875
Absorbance 280nm 150.64
Polar residues 14
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 28935900
Title Antibacterial and immunomodulatory activities of insect defensins-DLP2 and DLP4 against multidrug-resistant Staphylococcus aureus
Doi Not available
Year 2017
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 13462
This work is licensed under a Creative Commons Attribution 4.0 International License.