This work is licensed under a Creative Commons Attribution 4.0 International License.
Ribonuclease 7 (1-45) [C23,37S; K1,3,12, 28,32,35,38,R]
General Information
DRACP ID DRACP03905
Peptide Name Ribonuclease 7 (1-45) [C23,37S; K1,3,12, 28,32,35,38,R]
Sequence RPRGMTSSQWFRIQHMQPSPQASNSAMRNINRHTRRSRDLNTFLH
Sequence Length 45
UniProt ID Q9H1E1
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C227H364N84O65S3
Absent amino acids CEKVY
Common amino acids R
Mass 619105
Pl 12.98
Basic residues 11
Acidic residues 1
Hydrophobic residues 9
Net charge 10
Boman Index -17931
Hydrophobicity -130.22
Aliphatic Index 39.11
Half Life
Mammalian: 1.3 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 5500
Absorbance 280nm 125
Polar residues 14
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 31540052
Title Insight into the Antifungal Mechanism of Action of Human RNase N-terminus Derived Peptides
Doi Not available
Year 2019
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 14153
This work is licensed under a Creative Commons Attribution 4.0 International License.