Papiliocin [W2A]

General Information


DRACP ID  DRACP03906

Peptide Name   Papiliocin [W2A]

Sequence  RAKIFKKIEKVGRNVRDGIIKAGPAVAVVGQAATVVK

Sequence Length  37

UniProt ID  D8L127 

PubChem CID  Not available

Origin  Synthetic

Type  Synthetic peptide

Classification

  

Active ACP



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

Nature  Anticancer; Antibacterial



Structure Information


PDB ID  Not available

Predicted Structure  Not available

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Amidation

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C175H308N54O45

Absent amino acids  CHLMSWY

Common amino acids  V

Mass  453104

Pl  11.82

Basic residues  9

Acidic residues  2

Hydrophobic residues  18

Net charge  7

Boman Index  -4278

Hydrophobicity  16.76

Aliphatic Index  113.24

Half Life 
  Mammalian: 1 hour
  Yeast: 2 min
  E.coli: 2 min

Extinction Coefficient cystines  0

Absorbance 280nm  0

Polar residues  6

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 26156126

Title  Functional Roles of Aromatic Residues and Helices of Papiliocin in its Antimicrobial and Anti-inflammatory Activities

Doi Not available

Year  2015

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  14156

DRACP is developed by Dr.Zheng's team.