This work is licensed under a Creative Commons Attribution 4.0 International License.
Papiliocin [F5A]
General Information
DRACP ID DRACP03907
Peptide Name Papiliocin [F5A]
Sequence RWKIAKKIEKVGRNVRDGIIKAGPAVAVVGQAATVVK
Sequence Length 37
UniProt ID D8L127
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C177H309N55O45
Absent amino acids CFHLMSY
Common amino acids V
Mass 457008
Pl 11.82
Basic residues 9
Acidic residues 2
Hydrophobic residues 18
Net charge 7
Boman Index -4343
Hydrophobicity 6.76
Aliphatic Index 113.24
Half Life
Mammalian: 1 hour
Yeast: 2 min
E.coli: 2 min
Extinction Coefficient cystines 5500
Absorbance 280nm 152.78
Polar residues 6
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 26156126
Title Functional Roles of Aromatic Residues and Helices of Papiliocin in its Antimicrobial and Anti-inflammatory Activities
Doi Not available
Year 2015
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 14157
This work is licensed under a Creative Commons Attribution 4.0 International License.