This work is licensed under a Creative Commons Attribution 4.0 International License.
EK1, HCoV-OC43-HR2P [Y4Q,Q13E,D14Y,N17K,R18K,Q20E,V25K,N27,Q28E,N32D,D35E,I36L]
General Information
DRACP ID DRACP03983
Peptide Name EK1, HCoV-OC43-HR2P [Y4Q,Q13E,D14Y,N17K,R18K,Q20E,V25K,N27,Q28E,N32D,D35E,I36L]
Sequence SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL
Sequence Length 36
UniProt ID Q8BB25
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antiviral
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C196H317N43O64S
Absent amino acids CGHPRW
Common amino acids EL
Mass 495647
Pl 4.08
Basic residues 5
Acidic residues 10
Hydrophobic residues 13
Net charge -5
Boman Index -6303
Hydrophobicity -43.33
Aliphatic Index 119.17
Half Life
Mammalian: 4.4 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 2980
Absorbance 280nm 85.14
Polar residues 6
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 32047258
Title Fusion mechanism of 2019-nCoV and fusion inhibitors targeting HR1 domain in spike protein
Doi Not available
Year 2020
Literature 2
Pubmed ID 30989115
Title A pan-coronavirus fusion inhibitor targeting the HR1 domain of human coronavirus spike
Doi Not available
Year 2019
Literature 3
Pubmed ID 32231345
Title Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion
Doi Not available
Year 2020
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 15152
This work is licensed under a Creative Commons Attribution 4.0 International License.