This work is licensed under a Creative Commons Attribution 4.0 International License.
229E-HCoV-HR1P
General Information
DRACP ID DRACP03984
Peptide Name 229E-HCoV-HR1P
Sequence AASFNKAMTNIVDAFTGVNDAITQTSQALQTVATALNKIQDVVNQQGNSLNHLTSQ
Sequence Length 56
UniProt ID P15423
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antiviral
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C251H410N74O88S
Absent amino acids CEPRWY
Common amino acids ANQT
Mass 688578
Pl 5.49
Basic residues 3
Acidic residues 3
Hydrophobic residues 22
Net charge 0
Boman Index -7946
Hydrophobicity -13.93
Aliphatic Index 88.93
Half Life
Mammalian: 1.9 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 0
Absorbance 280nm 0
Polar residues 20
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 29415501
Title Peptide-Based Membrane Fusion Inhibitors Targeting HCoV-229E Spike Protein HR1 and HR2 Domains
Doi Not available
Year 2018
Literature 2
Pubmed ID 30989115
Title A pan-coronavirus fusion inhibitor targeting the HR1 domain of human coronavirus spike
Doi Not available
Year 2019
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 15165
This work is licensed under a Creative Commons Attribution 4.0 International License.