This work is licensed under a Creative Commons Attribution 4.0 International License.
MERS-CoV-HR2P
General Information
DRACP ID DRACP03986
Peptide Name MERS-CoV-HR2P
Sequence SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL
Sequence Length 36
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antiviral
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C185H307N43O61S
Absent amino acids CFGHPRW
Common amino acids L
Mass 476628
Pl 3.95
Basic residues 2
Acidic residues 5
Hydrophobic residues 14
Net charge -3
Boman Index -3327
Hydrophobicity 13.06
Aliphatic Index 138.06
Half Life
Mammalian: 100 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 2980
Absorbance 280nm 85.14
Polar residues 11
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 24473083
Title Structure-based discovery of Middle East respiratory syndrome coronavirus fusion inhibitor
Doi Not available
Year 2014
Literature 2
Pubmed ID 30646495
Title Potent MERS-CoV Fusion Inhibitory Peptides Identified From HR2 Domain in Spike Protein of Bat Coronavirus HKU4
Doi Not available
Year 2019
Literature 3
Pubmed ID 30989115
Title A pan-coronavirus fusion inhibitor targeting the HR1 domain of human coronavirus spike
Doi Not available
Year 2019
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 15168
This work is licensed under a Creative Commons Attribution 4.0 International License.