This work is licensed under a Creative Commons Attribution 4.0 International License.
General Information
DRACP ID DRACP04014
Peptide Name
Sequence EMTWEEWEKKIEEYTKKIEEILKKSQNQQIDL
Sequence Length 32
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antiviral
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C182H288N44O59S
Absent amino acids ACFGHPRV
Common amino acids E
Mass 462173
Pl 4.41
Basic residues 6
Acidic residues 9
Hydrophobic residues 8
Net charge -3
Boman Index -9191
Hydrophobicity -145.94
Aliphatic Index 73.13
Half Life
Mammalian: 1.1 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 12490
Absorbance 280nm 402.9
Polar residues 5
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 30901967
Title A Peptide-Based HIV-1 Fusion Inhibitor With Two Tail-Anchors and Palmitic Acid Exhibits Substantially Improved In Vitro and Ex Vivo Anti-HIV-1 Activity and Prolonged In Vivo Half-Life
Doi Not available
Year 2019
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 15603
This work is licensed under a Creative Commons Attribution 4.0 International License.