This work is licensed under a Creative Commons Attribution 4.0 International License.
General Information
DRACP ID DRACP04015
Peptide Name
Sequence EMTWEEWEKKIEEYIKKIEEILKKSQNQQIDL
Sequence Length 32
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antiviral
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C184H292N44O58S
Absent amino acids ACFGHPRV
Common amino acids E
Mass 463379
Pl 4.41
Basic residues 6
Acidic residues 9
Hydrophobic residues 9
Net charge -3
Boman Index -8442
Hydrophobicity -129.69
Aliphatic Index 85.31
Half Life
Mammalian: 1 hour
Yeast: 30 min
E.coli: >10 hour
Extinction Coefficient cystines 12490
Absorbance 280nm 402.9
Polar residues 4
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 30901967
Title A Peptide-Based HIV-1 Fusion Inhibitor With Two Tail-Anchors and Palmitic Acid Exhibits Substantially Improved In Vitro and Ex Vivo Anti-HIV-1 Activity and Prolonged In Vivo Half-Life
Doi Not available
Year 2019
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 15604
This work is licensed under a Creative Commons Attribution 4.0 International License.