General Information


DRACP ID  DRACP04015

Peptide Name  

Sequence  EMTWEEWEKKIEEYIKKIEEILKKSQNQQIDL

Sequence Length  32

UniProt ID  Not available

PubChem CID  Not available

Origin  Synthetic

Type  Synthetic peptide

Classification

  

Active ACP



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

Nature  Anticancer; Antiviral



Structure Information


PDB ID  Not available

Predicted Structure  Not available

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C184H292N44O58S

Absent amino acids  ACFGHPRV

Common amino acids  E

Mass  463379

Pl  4.41

Basic residues  6

Acidic residues  9

Hydrophobic residues  9

Net charge  -3

Boman Index  -8442

Hydrophobicity  -129.69

Aliphatic Index  85.31

Half Life 
  Mammalian: 1 hour
  Yeast: 30 min
  E.coli: >10 hour

Extinction Coefficient cystines  12490

Absorbance 280nm  402.9

Polar residues  4

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 30901967

Title  A Peptide-Based HIV-1 Fusion Inhibitor With Two Tail-Anchors and Palmitic Acid Exhibits Substantially Improved In Vitro and Ex Vivo Anti-HIV-1 Activity and Prolonged In Vivo Half-Life

Doi Not available

Year  2019

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  15604

DRACP is developed by Dr.Zheng's team.