This work is licensed under a Creative Commons Attribution 4.0 International License.
General Information
DRACP ID DRACP04016
Peptide Name
Sequence EMTWEEWEKKIEEYIKKIEEILKKSQNQQIDLGSGX
Sequence Length 36
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antiviral
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification C16
Other Modification None
Chiral L
Physicochemical Information
Formula C191H301N47O61S
Absent amino acids ACFHPRV
Common amino acids E
Mass 499830
Pl 4.41
Basic residues 6
Acidic residues 9
Hydrophobic residues 9
Net charge -3
Boman Index -8594
Hydrophobicity -119.72
Aliphatic Index 75.83
Half Life
/
Extinction Coefficient cystines 12490
Absorbance 280nm 356.86
Polar residues 7
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 30901967
Title A Peptide-Based HIV-1 Fusion Inhibitor With Two Tail-Anchors and Palmitic Acid Exhibits Substantially Improved In Vitro and Ex Vivo Anti-HIV-1 Activity and Prolonged In Vivo Half-Life
Doi Not available
Year 2019
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 15605
This work is licensed under a Creative Commons Attribution 4.0 International License.