Tat (47鈥?7)-Arenicin-3 [G1,12A; Y5N; Y17H], T11N2

General Information


DRACP ID  DRACP04067

Peptide Name   Tat (47鈥?7)-Arenicin-3 [G1,12A; Y5N; Y17H], T11N2

Sequence  YGRKKRRQRRRAFCWNVCVYRNAVRVCHRRCN

Sequence Length  32

UniProt ID  A0A3F2YLM5 

PubChem CID  Not available

Origin  Synthetic

Type  Synthetic peptide

Classification

  

Active ACP



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

Nature  Anticancer; Antibacterial



Structure Information


PDB ID  Not available

Predicted Structure  Not available

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C173H285N71O39S4

Absent amino acids  DEILMPST

Common amino acids  R

Mass  466496

Pl  12.15

Basic residues  13

Acidic residues  0

Hydrophobic residues  8

Net charge  13

Boman Index  -15955

Hydrophobicity  -127.19

Aliphatic Index  42.5

Half Life 
  Mammalian: 1 hour
  Yeast: 2 min
  E.coli: 2 min

Extinction Coefficient cystines  8730

Absorbance 280nm  281.61

Polar residues  10

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 29329001

Title  Improved antibacterial activity of a marine peptide-N2 against intracellular Salmonella typhimurium by conjugating with cell-penetrating peptides-bLFcin6/Tat11

Doi Not available

Year  2018

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  16574

DRACP is developed by Dr.Zheng's team.