This work is licensed under a Creative Commons Attribution 4.0 International License.
Tat (47鈥?7)-Arenicin-3 [G1,12A; Y5N; Y17H], T11N2
General Information
DRACP ID DRACP04067
Peptide Name Tat (47鈥?7)-Arenicin-3 [G1,12A; Y5N; Y17H], T11N2
Sequence YGRKKRRQRRRAFCWNVCVYRNAVRVCHRRCN
Sequence Length 32
UniProt ID A0A3F2YLM5
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C173H285N71O39S4
Absent amino acids DEILMPST
Common amino acids R
Mass 466496
Pl 12.15
Basic residues 13
Acidic residues 0
Hydrophobic residues 8
Net charge 13
Boman Index -15955
Hydrophobicity -127.19
Aliphatic Index 42.5
Half Life
Mammalian: 1 hour
Yeast: 2 min
E.coli: 2 min
Extinction Coefficient cystines 8730
Absorbance 280nm 281.61
Polar residues 10
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 29329001
Title Improved antibacterial activity of a marine peptide-N2 against intracellular Salmonella typhimurium by conjugating with cell-penetrating peptides-bLFcin6/Tat11
Doi Not available
Year 2018
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 16574
This work is licensed under a Creative Commons Attribution 4.0 International License.