This work is licensed under a Creative Commons Attribution 4.0 International License.
MBD-4 (11-40) / P9 [H21R,K23R,K28R], P9R
General Information
DRACP ID DRACP04089
Peptide Name MBD-4 (11-40) / P9 [H21R,K23R,K28R], P9R
Sequence NGAICWGPCPTAFRQIGNCGRFRVRCCRIR
Sequence Length 30
UniProt ID P82019
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antiviral
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C144H232N52O35S5
Absent amino acids DEHKLMSY
Common amino acids R
Mass 392951
Pl 10.51
Basic residues 6
Acidic residues 0
Hydrophobic residues 9
Net charge 6
Boman Index -7004
Hydrophobicity -15
Aliphatic Index 55.33
Half Life
Mammalian: 100 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 5750
Absorbance 280nm 198.28
Polar residues 12
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 32843628
Title A broad-spectrum virus- and host-targeting peptide against respiratory viruses including influenza virus and SARS-CoV-2
Doi Not available
Year 2020
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 16965
This work is licensed under a Creative Commons Attribution 4.0 International License.