This work is licensed under a Creative Commons Attribution 4.0 International License.
MDAP-2 [Q35R]
General Information
DRACP ID DRACP04091
Peptide Name MDAP-2 [Q35R]
Sequence SRDSRPVQPRVQPPPPPPKQKPSIYDTPIRRPGGRKTMYA
Sequence Length 40
UniProt ID A0A088N522
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C201H328N64O55S
Absent amino acids CEFHLNW
Common amino acids P
Mass 524903
Pl 11.92
Basic residues 9
Acidic residues 2
Hydrophobic residues 5
Net charge 7
Boman Index -13189
Hydrophobicity -149.75
Aliphatic Index 36.5
Half Life
Mammalian: 1.1 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 2980
Absorbance 280nm 76.41
Polar residues 9
Amino acid distribution
Literature Information
Literature 1
Pubmed ID Not available
Title Design and Characterization of a Novel Hybrid Antimicrobial Peptide OM19R Based on Oncocin and MDAP-2
Doi Not available
Year 2019
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 16977
This work is licensed under a Creative Commons Attribution 4.0 International License.