This work is licensed under a Creative Commons Attribution 4.0 International License.
LBP14-G4 S-N6
General Information
DRACP ID DRACP04119
Peptide Name LBP14-G4 S-N6
Sequence RVQGRWKVRASFFKGGGGSGFAWNVCVYRNGVRVCHRRAN
Sequence Length 40
UniProt ID A0A3F2YLM5
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C200H309N71O48S2
Absent amino acids DEILMPT
Common amino acids GR
Mass 523602
Pl 12.39
Basic residues 10
Acidic residues 0
Hydrophobic residues 14
Net charge 10
Boman Index -10019
Hydrophobicity -50
Aliphatic Index 51
Half Life
Mammalian: 1 hour
Yeast: 2 min
E.coli: 2 min
Extinction Coefficient cystines 12615
Absorbance 280nm 323.46
Polar residues 15
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 31974490
Title Development of chimeric peptides to facilitate the neutralisation of lipopolysaccharides during bactericidal targeting of multidrug-resistant Escherichia coli
Doi Not available
Year 2020
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 17276
This work is licensed under a Creative Commons Attribution 4.0 International License.