This work is licensed under a Creative Commons Attribution 4.0 International License.
Defensin-like peptide 4/DLP4 [K32G], ID13
General Information
DRACP ID DRACP04120
Peptide Name Defensin-like peptide 4/DLP4 [K32G], ID13
Sequence ATCDLLSPFKVGHAACAAHCIARGKRGGWCDGRAVCNCRK
Sequence Length 40
UniProt ID W5U4X3
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C175H285N61O48S6
Absent amino acids EMQY
Common amino acids A
Mass 489980
Pl 8.9
Basic residues 9
Acidic residues 2
Hydrophobic residues 14
Net charge 7
Boman Index -6250
Hydrophobicity -4.25
Aliphatic Index 61.25
Half Life
Mammalian: 1 hour
Yeast: 2 min
E.coli: 2 min
Extinction Coefficient cystines 5875
Absorbance 280nm 150.64
Polar residues 14
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 32506158
Title Therapeutic potential of a designed CS伪尾 peptide ID13 in Staphylococcus aureus-induced endometritis of mice
Doi Not available
Year 2020
Literature 2
Pubmed ID 32582062
Title An Enhanced Variant Designed From DLP4 Cationic Peptide Against Staphylococcus aureus CVCC 546
Doi Not available
Year 2020
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 17281
This work is licensed under a Creative Commons Attribution 4.0 International License.