This work is licensed under a Creative Commons Attribution 4.0 International License.
Defensin-like protein 1
General Information
DRACP ID DRACP04128
Peptide Name Defensin-like protein 1
Sequence RICRRRSAGFKGPCVSNKNCAQVCMQEGWGGGNCDGPLRRCKCMRRC
Sequence Length 47
UniProt ID P20230
PubChem CID Not available
Origin Plantae
Type Native peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C209H352N80O59S10
Absent amino acids HTY
Common amino acids CR
Mass 607088
Pl 9.9
Basic residues 11
Acidic residues 2
Hydrophobic residues 8
Net charge 9
Boman Index -14097
Hydrophobicity -71.91
Aliphatic Index 33.19
Half Life
Mammalian: 2.8 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 6000
Absorbance 280nm 130.43
Polar residues 20
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 33396521
Title Study on the Inhibitory Activity of a Synthetic peptide Defensin Derived from Barley Endosperm against Common Food Spoilage Yeast
Doi Not available
Year 2020
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 17410
This work is licensed under a Creative Commons Attribution 4.0 International License.