Human beta-defensin-4, hBD4

General Information


DRACP ID  DRACP04208

Peptide Name   Human beta-defensin-4, hBD4

Sequence  EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP

Sequence Length  50

UniProt ID  Q8WTQ1 

PubChem CID  Not available

Origin  Animalia

Type  Native peptide

Classification

  

Active ACP



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

Nature  Anticancer; Antibacterial



Structure Information


PDB ID  Not available

Predicted Structure  Not available

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C254H410N82O74S6

Absent amino acids  HMV

Common amino acids  R

Mass  686309

Pl  9.13

Basic residues  12

Acidic residues  6

Hydrophobic residues  10

Net charge  6

Boman Index  -17104

Hydrophobicity  -100.8

Aliphatic Index  50.8

Half Life 
  Mammalian:
  Yeast:
  E.coli:

Extinction Coefficient cystines  10345

Absorbance 280nm  211.12

Polar residues  19

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 34025617

Title  A Chimeric Cationic Peptide Composed of Human 尾-Defensin 3 and Human 尾-Defensin 4 Exhibits Improved Antibacterial Activity and Salt Resistance

Doi Not available

Year  2021

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  18490

DRACP is developed by Dr.Zheng's team.