This work is licensed under a Creative Commons Attribution 4.0 International License.
General Information
DRACP ID DRACP04254
Peptide Name
Sequence KKHRKHRKHRKHWKKWSKKWKHWIPQCKKFGKK
Sequence Length 33
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C209H329N71O36S
Absent amino acids ADELMNTVY
Common amino acids K
Mass 501537
Pl 12.41
Basic residues 22
Acidic residues 0
Hydrophobic residues 6
Net charge 22
Boman Index -13526
Hydrophobicity -255.15
Aliphatic Index 11.82
Half Life
Mammalian: 2.8 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 22000
Absorbance 280nm 687.5
Polar residues 3
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 34733268
Title Improving the Activity of Antimicrobial Peptides Against Aquatic Pathogen Bacteria by Amino Acid Substitutions and Changing the Ratio of Hydrophobic Residues
Doi Not available
Year 2021
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 18707
This work is licensed under a Creative Commons Attribution 4.0 International License.