This work is licensed under a Creative Commons Attribution 4.0 International License.
Esculentin-2 HYba2
General Information
DRACP ID DRACP04341
Peptide Name Esculentin-2 HYba2
Sequence SILSLFKMGAKALGKTLIKQAGKAGAEYVACKATNQC
Sequence Length 37
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C168H286N46O48S3
Absent amino acids DHPRW
Common amino acids A
Mass 445693
Pl 10.3
Basic residues 6
Acidic residues 1
Hydrophobic residues 15
Net charge 5
Boman Index -1203
Hydrophobicity 20
Aliphatic Index 90
Half Life
Mammalian: 1.9 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 1615
Absorbance 280nm 44.86
Polar residues 12
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 31328553
Title Identification and functional characterisation of Esculentin-2 HYba peptides and their C-terminally amidated analogs from the skin secretion of an endemic frog
Doi Not available
Year 2021
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 18987
This work is licensed under a Creative Commons Attribution 4.0 International License.