This work is licensed under a Creative Commons Attribution 4.0 International License.
Heteroscorpine-1 (1-38), CeHS-1
General Information
DRACP ID DRACP04357
Peptide Name Heteroscorpine-1 (1-38), CeHS-1
Sequence GWINEEKIQKKIDEKIGNNILGGMAKAVVHKLAKGEFQ
Sequence Length 38
UniProt ID P0C2F4
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C190H313N53O54S
Absent amino acids CPRSTY
Common amino acids K
Mass 489614
Pl 10.04
Basic residues 8
Acidic residues 5
Hydrophobic residues 14
Net charge 3
Boman Index -5016
Hydrophobicity -52.11
Aliphatic Index 95
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 5500
Absorbance 280nm 148.65
Polar residues 8
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 34641415
Title Novel Antimicrobial Peptides from a Cecropin-Like Region of Heteroscorpine-1 from Heterometrus laoticus Venom with Membrane Disruption Activity
Doi Not available
Year 2021
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 19015
This work is licensed under a Creative Commons Attribution 4.0 International License.