Heteroscorpine-1 (1-38)[E5,6Del;D13Del;N19K;G27,P28Ins], CeHS-1 GPK

General Information


DRACP ID  DRACP04359

Peptide Name   Heteroscorpine-1 (1-38)[E5,6Del;D13Del;N19K;G27,P28Ins], CeHS-1 GPK

Sequence  GWINKIQKKIEKIGNKILGGMAKAGPVVHKLAKGEFQ

Sequence Length  37

UniProt ID  P0C2F4 

PubChem CID  Not available

Origin  Synthetic

Type  Synthetic peptide

Classification

  

Active ACP



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

Nature  Anticancer; Antibacterial



Structure Information


PDB ID  Not available

Predicted Structure  Not available

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C185H310N52O46S

Absent amino acids  CDRSTY

Common amino acids  K

Mass  467322

Pl  11.02

Basic residues  9

Acidic residues  2

Hydrophobic residues  14

Net charge  7

Boman Index  -2579

Hydrophobicity  -31.62

Aliphatic Index  97.57

Half Life 
  Mammalian: 30 hour
  Yeast: >20 hour
  E.coli: >10 hour

Extinction Coefficient cystines  5500

Absorbance 280nm  152.78

Polar residues  8

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 34641415

Title  Novel Antimicrobial Peptides from a Cecropin-Like Region of Heteroscorpine-1 from Heterometrus laoticus Venom with Membrane Disruption Activity

Doi Not available

Year  2021

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  19017

DRACP is developed by Dr.Zheng's team.