This work is licensed under a Creative Commons Attribution 4.0 International License.
Heteroscorpine-1 (1-38)[E5,6Del;D13Del;N19K;G27,P28Ins], CeHS-1 GPK
General Information
DRACP ID DRACP04359
Peptide Name Heteroscorpine-1 (1-38)[E5,6Del;D13Del;N19K;G27,P28Ins], CeHS-1 GPK
Sequence GWINKIQKKIEKIGNKILGGMAKAGPVVHKLAKGEFQ
Sequence Length 37
UniProt ID P0C2F4
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C185H310N52O46S
Absent amino acids CDRSTY
Common amino acids K
Mass 467322
Pl 11.02
Basic residues 9
Acidic residues 2
Hydrophobic residues 14
Net charge 7
Boman Index -2579
Hydrophobicity -31.62
Aliphatic Index 97.57
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 5500
Absorbance 280nm 152.78
Polar residues 8
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 34641415
Title Novel Antimicrobial Peptides from a Cecropin-Like Region of Heteroscorpine-1 from Heterometrus laoticus Venom with Membrane Disruption Activity
Doi Not available
Year 2021
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID 19017
This work is licensed under a Creative Commons Attribution 4.0 International License.