EBOV-GP (610-639)[E611G,P612I,H613E,W615L,T616S,T620K,Q625K]-C

General Information


DRACP ID  DRACP04390

Peptide Name   EBOV-GP (610-639)[E611G,P612I,H613E,W615L,T616S,T620K,Q625K]-C

Sequence  IGIEDLSKNIKDKIDKIIHDFVDKTLPDQGX

Sequence Length  31

UniProt ID  Q05320 

PubChem CID  Not available

Origin  Synthetic

Type  Synthetic peptide

Classification

  

Active ACP



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

Nature  Anticancer; Antiviral



Structure Information


PDB ID  Not available

Predicted Structure  Not available

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Acetylation

C-terminal Modification  Amidation

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C152H249N39O48

Absent amino acids  ACMRWY

Common amino acids  DI

Mass  403621

Pl  4.74

Basic residues  6

Acidic residues  7

Hydrophobic residues  10

Net charge  -1

Boman Index  -6143

Hydrophobicity  -53.23

Aliphatic Index  110

Half Life 
  /

Extinction Coefficient cystines  0

Absorbance 280nm  0

Polar residues  5

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 31473342

Title  Cholesterol-conjugated stapled peptides inhibit Ebola and Marburg viruses in vitro and in vivo

Doi Not available

Year  2019

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  19282

DRACP is developed by Dr.Zheng's team.