Octopromycin

General Information


DRACP ID  DRACP04399

Peptide Name   Octopromycin

Sequence  RRLIRTDTGPIIYDYFKDQLLKKGMVILRESMKNLKGM

Sequence Length  38

UniProt ID  A0A6P7S4G6 

PubChem CID  Not available

Origin  Synthetic

Type  Synthetic peptide

Classification

  

Active ACP



Activity Information


Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

Nature  Anticancer; Antibacterial



Structure Information


PDB ID  Not available

Predicted Structure  Not available

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C203H343N57O54S3

Absent amino acids  ACHW

Common amino acids  KL

Mass  520264

Pl  10.74

Basic residues  9

Acidic residues  4

Hydrophobic residues  11

Net charge  5

Boman Index  -8023

Hydrophobicity  -43.16

Aliphatic Index  100

Half Life 
  Mammalian: 1.2 hour
  Yeast: >20 hour
  E.coli: >10 hour

Extinction Coefficient cystines  2980

Absorbance 280nm  80.54

Polar residues  9

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 34311097

Title  Octopromycin: Antibacterial and antibiofilm functions of a novel peptide derived from Octopus minor against multidrug-resistant Acinetobacter baumannii

Doi Not available

Year  2021

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  19459

DRACP is developed by Dr.Zheng's team.