This work is licensed under a Creative Commons Attribution 4.0 International License.
MTX-GFLG-Melittin
General Information
DRACP ID DRACP06039
Peptide Name MTX-GFLG-Melittin
Sequence XGFLGGIGAVLKVLTTGLPALISWIKRKRQQ
Sequence Length 31
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Targeted peptide conjugates
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification X=Methotrexate
Chiral L
Physicochemical Information
Formula C150H252N42O35
Absent amino acids CDEHMNY
Common amino acids GL
Mass 384922
Pl 12.55
Basic residues 5
Acidic residues 0
Hydrophobic residues 14
Net charge 5
Boman Index -504
Hydrophobicity 41.61
Aliphatic Index 125.81
Half Life
/
Extinction Coefficient cystines 5500
Absorbance 280nm 183.33
Polar residues 8
Amino acid distribution
Literature Information
Literature 1
Pubmed ID Not available
Title Not available
Doi Not available
Year Not available
Patent
Patent ID CN115317622A
Patent Title Preparation and application of anti-tumor polypeptide coupling medicine
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.