This work is licensed under a Creative Commons Attribution 4.0 International License.
SEQ ID NO: 2 of Patent CN113135987A
General Information
DRACP ID DRACP06049
Peptide Name SEQ ID NO: 2 of Patent CN113135987A
Sequence DPLVRRQRVQDLMAQMQGPYNFIQDSMLDFENQTL
Sequence Length 35
UniProt ID Not available
PubChem CID Not available
Origin Synthetic (Derived from Caprin1)
Type Synthetic peptide
Classification
Cancer targeted peptides
Activity Information
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target G3BP1
Affinity Not available
Mechanism The compound can be competitively combined with the G3BP1 protein to specifically block the interaction between the Caprin1 and the G3BP1 protein and inhibit generation of stress particles so as to treat diseases related to the generation of SGs, such as tumors or neurodegenerative diseases.
Nature Anticancer
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C181H286N52O57S3
Absent amino acids CHKW
Common amino acids Q
Mass 480541
Pl 4.19
Basic residues 3
Acidic residues 5
Hydrophobic residues 10
Net charge -2
Boman Index -9064
Hydrophobicity -69.14
Aliphatic Index 75.14
Half Life
Mammalian: 1.1 hour
Yeast: 3 min
E.coli: >10 hour
Extinction Coefficient cystines 1490
Absorbance 280nm 43.82
Polar residues 6
Amino acid distribution
Literature Information
Literature 1
Pubmed ID Not available
Title Not available
Doi Not available
Year Not available
Patent
Patent ID CN113135987A
Patent Title Active peptide derived from Caprin1 and application thereof
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.