This work is licensed under a Creative Commons Attribution 4.0 International License.
LfcinB (17-31)4
General Information
DRACP ID DRACP00787
Peptide Name LfcinB (17-31)4
Sequence FKARRWQWRMKKLGAFKARRWQWRMKKLGAKXC [Precursor of tetrameric peptide]
Sequence Length 33
UniProt ID Not available
PubChem CID Not available
Origin Bovine Lactoferricin
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| MDA-MB-468 | Breast adenocarcinoma | Carcinoma | IC50=5 μM | MTT assay | 2h | 1 |
| MDA-MB-231 | Breast adenocarcinoma | Carcinoma | IC50=9 μM | MTT assay | 2h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antitumor; Antimicrobial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification X=Ahx
Chiral L
Physicochemical Information
Formula C191H301N63O34S3
Absent amino acids DEHINPSTVY
Common amino acids K
Mass 480103
Pl 12.82
Basic residues 13
Acidic residues 0
Hydrophobic residues 12
Net charge 13
Boman Index -9923
Hydrophobicity -118.18
Aliphatic Index 35.76
Half Life
/
Extinction Coefficient cystines 22000
Absorbance 280nm 687.5
Polar residues 3
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 28961215
Title Antibacterial Synthetic Peptides Derived from Bovine Lactoferricin Exhibit Cytotoxic Effect against MDA-MB-468 and MDA-MB-231 Breast Cancer Cell Lines
Year 2017
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.