LfcinB (17-31)4

General Information


DRACP ID  DRACP00787

Peptide Name   LfcinB (17-31)4

Sequence  FKARRWQWRMKKLGAFKARRWQWRMKKLGAKXC [Precursor of tetrameric peptide]

Sequence Length  33

UniProt ID  Not available

PubChem CID  Not available

Origin  Bovine Lactoferricin

Type  Native peptide

Classification

  

Active ACP



Activity Information


Cell Line Disease Cancer Classified Activity Assay Testing Time Literature
MDA-MB-468 Breast adenocarcinoma Carcinoma IC50=5 μM MTT assay 2h 1
MDA-MB-231 Breast adenocarcinoma Carcinoma IC50=9 μM MTT assay 2h 1

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

Nature  Anticancer; Antitumor; Antimicrobial



Structure Information


PDB ID  Not available

Predicted Structure  Not available

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  X=Ahx

Chiral  L



Physicochemical Information


Formula  C191H301N63O34S3

Absent amino acids  DEHINPSTVY

Common amino acids  K

Mass  480103

Pl  12.82

Basic residues  13

Acidic residues  0

Hydrophobic residues  12

Net charge  13

Boman Index  -9923

Hydrophobicity  -118.18

Aliphatic Index  35.76

Half Life 
  /

Extinction Coefficient cystines  22000

Absorbance 280nm  687.5

Polar residues  3

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 28961215

Title  Antibacterial Synthetic Peptides Derived from Bovine Lactoferricin Exhibit Cytotoxic Effect against MDA-MB-468 and MDA-MB-231 Breast Cancer Cell Lines

Doi 10.3390/molecules22101641

Year  2017

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DRACP is developed by Dr.Zheng's team.