This work is licensed under a Creative Commons Attribution 4.0 International License.
| DRACP ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DRACP00786 | LfcinB (17-31)2 | FKARRWQWRMKKLGAFKARRWQWRMKKLGAKX | 32 | Bovine Lactoferricin |
| DRACP00787 | LfcinB (17-31)4 | FKARRWQWRMKKLGAFKARRWQWRMKKLGAKXC [Precursor of tetrameric peptide] | 33 | Bovine Lactoferricin |
| DRACP00788 | LfcinB (20–25)2 | RRWQWRRRWQWRKX | 14 | Bovine Lactoferricin |
| DRACP00789 | LfcinB (20–25)4 | RRWQWRRRWQWRKXC [Precursor of tetrameric peptide] | 15 | Bovine Lactoferricin |
| DRACP00790 | LfcinB (20–30)2 | RWQWRMKKLGRWQWRMKKLGKX | 22 | Bovine Lactoferricin |
| DRACP00791 | LfcinB (20–30)4 | RWQWRMKKLGRWQWRMKKLGKXC [Precursor of tetrameric peptide] | 23 | Bovine Lactoferricin |
| DRACP00792 | LfcinB (17-31) | FKARRWQWRMKKLGA | 15 | Bovine Lactoferricin |
| DRACP00793 | LfcinB (17-31)cyc | CFKARRWQWRMKKLGAXC | 18 | Bovine Lactoferricin |
| DRACP00794 | LfcinB (20–25) | RRWQWR | 6 | Bovine Lactoferricin |
| DRACP00795 | LfcinB (20–25)cyc | CRRWQWRXC | 9 | Bovine Lactoferricin |
| DRACP00796 | LfcinB (20–30) | RWQWRMKKLG | 10 | Bovine Lactoferricin |
| DRACP00797 | LfcinB (20–30)cyc | CRWQWRMKKLGXC | 13 | Bovine Lactoferricin |
| DRACP00875 | CLP | LP | 2 | marine natural metabolite |
| DRACP01014 | B18K | GFQKVKAQAATCNHTVMA | 18 | Synthetic |
| DRACP01015 | B18KA | GFQKVKAQALTCLHTVMA | 18 | Synthetic |
| DRACP01016 | B18KL | GFQKVKAQALTCLHTVMA | 18 | Synthetic |
| DRACP01017 | B18I | GIGKAIAKAIACIAKAIA | 18 | Synthetic |
| DRACP01018 | B18L | GLGKALAKALACLAKALA | 18 | Synthetic |
This work is licensed under a Creative Commons Attribution 4.0 International License.