This work is licensed under a Creative Commons Attribution 4.0 International License.
| DRACP ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DRACP04908 | aa 129-138; partial loop-4+loop-5 | KITRCPMIPC | 10 | Synthetic |
| DRACP04909 | aa 129-145; partial loop-4+loop-5 | KITRCPMIPCYISSPDE | 17 | Synthetic |
| DRACP04933 | LVPRGSRAGSPSGGPFCALARQPLTGARLMSGLFFALHET | 40 | Synthetic | |
| DRACP04944 | MFSPILSLEIILALATLQSVFAQPVICTTVGSAAEGS | 37 | Synthetic | |
| DRACP04968 | RAGSPSGGPFCALARQPLTGSPPNERAFFCSSRDV | 35 | Synthetic | |
| DRACP04969 | RCRLAERRQIAK | 12 | Synthetic | |
| DRACP05002 | SVSGGGHHHHHHGGG | 15 | Synthetic | |
| DRACP05003 | synVB1 | SVSRAGSPSGGPFC | 14 | Synthetic |
| DRACP05018 | Loop 5 | TRCPMIPCYI | 10 | Synthetic |
| DRACP05047 | SEQ ID NO:48 of US7365159B2 | YPYDVPDYASL | 11 | Synthetic |
| DRACP05051 | Tat (43-60) | LGISYGRKKRRQRRRPPQ | 18 | Protein derived |
| DRACP05054 | Tat (49-56) | RKKRRQRR | 8 | Protein derived |
| DRACP05055 | Tat (49-55) | RKKRRQR | 7 | Protein derived |
| DRACP05056 | Tat (50-57) | KKRRQRRR | 8 | Protein derived |
| DRACP05057 | Tat (51-57) | KRRQRRR | 7 | Protein derived |
| DRACP05058 | D-Tat (49-57) | rkkrrqrrr | 9 | Protein derived |
| DRACP05059 | Retro - Tat (57-49) | RRRQRRKKR | 9 | Protein derived |
| DRACP05060 | D-Tat (57-49) | rrrqrrkkr | 9 | Protein derived |
| DRACP05061 | Ala49 substitution mutant of Tat (49-57) | AKKRRQRRR | 9 | Protein derived |
| DRACP05062 | Ala50 substitution mutant of Tat (49-57) | RAKRRQRRR | 9 | Protein derived |
| DRACP05063 | Ala51 substitution mutant of Tat (49-57) | RKARRQRRR | 9 | Protein derived |
| DRACP05064 | Ala52 substitution mutant of Tat (49-57) | RKKARQRRR | 9 | Protein derived |
| DRACP05065 | Ala53 substitution mutant of Tat (49-57) | RKKRAQRRR | 9 | Protein derived |
| DRACP05066 | Ala54 substitution mutant of Tat (49-57) | RKKRRARRR | 9 | Protein derived |
| DRACP05067 | Ala55 substitution mutant of Tat (49-57) | RKKRRQARR | 9 | Protein derived |
| DRACP05068 | Ala56 substitution mutant of Tat (49-57) | RKKRRQRAR | 9 | Protein derived |
| DRACP05069 | Ala57 substitution mutant of Tat (49-57) | RKKRRQRRA | 9 | Protein derived |
| DRACP05076 | R6 | RRRRRR | 6 | Synthetic |
| DRACP05077 | D-R5 | rrrrr | 5 | Synthetic |
| DRACP05078 | D-R7 | rrrrrrr | 7 | Synthetic |
This work is licensed under a Creative Commons Attribution 4.0 International License.