This work is licensed under a Creative Commons Attribution 4.0 International License.
| DRACP ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DRACP05040 | Callyaerin G | XLPPPPLPFFF | 11 | |
| DRACP05041 | Callyaerin F | XVPVFPPLFI | 10 | |
| DRACP05042 | Callyaerin H | XVPVFPPLPI | 10 | |
| DRACP05043 | YCNIHQVCHYAQRNDRSYWL | 20 | Synthetic | |
| DRACP05044 | Hexastatin-2 | YCNINEVCHYARRNDKSYWL | 20 | Homo sapiens (α6 CIV) |
| DRACP05045 | YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWK | 35 | Synthetic | |
| DRACP05046 | msurvivin | YLKNYRIATFKNWPF | 15 | Synthetic |
| DRACP05047 | SEQ ID NO:48 of US7365159B2 | YPYDVPDYASL | 11 | Synthetic |
| DRACP05048 | TL1AL72-L251(rev) | YRIPIVRRLQRR | 12 | Synthetic |
| DRACP05049 | KV11 | YTMNPRKLFDY | 11 | Kringle 5 |
| DRACP05050 | TL1AV84-L251(fw) | YTYGLCTSSR | 10 | Synthetic |
| DRACP05051 | Tat (43-60) | LGISYGRKKRRQRRRPPQ | 18 | Protein derived |
| DRACP05052 | Tat (37-60) | FITKALGISYGRKKRRQRRRPPQ | 23 | Protein derived |
| DRACP05053 | Tat (37-53) | FITKALGISYGRKKRR | 16 | Protein derived |
| DRACP05054 | Tat (49-56) | RKKRRQRR | 8 | Protein derived |
| DRACP05055 | Tat (49-55) | RKKRRQR | 7 | Protein derived |
| DRACP05056 | Tat (50-57) | KKRRQRRR | 8 | Protein derived |
| DRACP05057 | Tat (51-57) | KRRQRRR | 7 | Protein derived |
| DRACP05059 | Retro - Tat (57-49) | RRRQRRKKR | 9 | Protein derived |
| DRACP05061 | Ala49 substitution mutant of Tat (49-57) | AKKRRQRRR | 9 | Protein derived |
| DRACP05062 | Ala50 substitution mutant of Tat (49-57) | RAKRRQRRR | 9 | Protein derived |
| DRACP05063 | Ala51 substitution mutant of Tat (49-57) | RKARRQRRR | 9 | Protein derived |
| DRACP05064 | Ala52 substitution mutant of Tat (49-57) | RKKARQRRR | 9 | Protein derived |
| DRACP05065 | Ala53 substitution mutant of Tat (49-57) | RKKRAQRRR | 9 | Protein derived |
| DRACP05066 | Ala54 substitution mutant of Tat (49-57) | RKKRRARRR | 9 | Protein derived |
| DRACP05067 | Ala55 substitution mutant of Tat (49-57) | RKKRRQARR | 9 | Protein derived |
| DRACP05068 | Ala56 substitution mutant of Tat (49-57) | RKKRRQRAR | 9 | Protein derived |
| DRACP05069 | Ala57 substitution mutant of Tat (49-57) | RKKRRQRRA | 9 | Protein derived |
| DRACP05070 | Arg deletion mutant of Tat (48-60) | GRKKRRQRRPPQC | 13 | Protein derived |
| DRACP05071 | Arg deletion mutant of Tat (48-60) | GRKKRRQRPPQC | 12 | Protein derived |
This work is licensed under a Creative Commons Attribution 4.0 International License.