This work is licensed under a Creative Commons Attribution 4.0 International License.
| DRACP ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DRACP01126 | CMAP-L-252 | KFKKFFKFMVKKKKF | 15 | Not available |
| DRACP01127 | CMAP-L-25 | KKFFKKMKKFVKKFF | 15 | Not available |
| DRACP01128 | CMAP-L-242 | KKFFKKMKKFVKKFL | 15 | Not available |
| DRACP01129 | CMAP-L-24 | KKFFKKMKKLVKKFF | 15 | Not available |
| DRACP01130 | CMAP-L-23 | KKFFKKMKSFFKKFF | 15 | Not available |
| DRACP01131 | CMAP-L-232 | KKFFKKMSFFFFKKK | 15 | Not available |
| DRACP01132 | CMAP-L-241 | KKFFKLVKKKMKKFF | 15 | Not available |
| DRACP01133 | CMAP-L-20 | KKFFSKMKSFFKKFF | 15 | Not available |
| DRACP01134 | CMAP-L-202 | KKFFSKSMKSFFFFKK | 16 | Not available |
| DRACP01135 | CMAP-L-253 | KKKKFFMFVFFKKKK | 15 | Not available |
| DRACP01136 | CMAP-L-243 | KKKKFFMLVKKKKFF | 15 | Not available |
| DRACP01137 | CMAP-L-233 | KKKKFFMSFFFKKKF | 15 | Not available |
| DRACP01138 | CMAP-L-201 | KKKKFFSMSFFKKFF | 15 | Not available |
| DRACP01139 | CB1a, Cecropin-B1a | KWKVFKKIEKKWKVFKKIEKAGPKWKVFKKIEK | 33 | Not available |
| DRACP01140 | ALT614 | MADIKQEHDTELDQNYSLGSNTDPKNMQELTQYVQTLLQSVQDKFQTMSDQILNRIDEMGSRIDDLEKNISDLMTQAGVEGPDK | 84 | Antlion |
| DRACP01141 | SEQ ID NO 19 from EP1783140A3 | ADGAPRPGAPLA | 12 | Screen of phage display peptide library |
| DRACP01142 | SEQ ID NO 17 from EP1783140A3 | APRPG | 5 | Screen of phage display peptide library |
| DRACP01143 | SEQ ID NO 6 from EP1783140A3 | ASSSYPLIHWRPWAR | 15 | Screen of phage display peptide library |
| DRACP01144 | SEQ ID NO 13 from EP1783140A3 | DRWRPALP | 8 | Screen of phage display peptide library |
| DRACP01145 | SEQ ID NO 5 from EP1783140A3 | DRWRPALPVVLFPLH | 15 | Screen of phage display peptide library |
| DRACP01146 | SEQ ID NO 33 from EP1783140A3 | HARPW | 5 | Screen of phage display peptide library |
| DRACP01147 | SEQ ID NO 34 from EP1783140A3 | HWAPW | 5 | Screen of phage display peptide library |
| DRACP01148 | SEQ ID NO 35 from EP1783140A3 | HWRAW | 5 | Screen of phage display peptide library |
| DRACP01149 | SEQ ID NO 29 from EP1783140A3 | HWRP | 4 | Screen of phage display peptide library |
| DRACP01150 | SEQ ID NO 16 from EP1783140A3 | HWRPW | 5 | Screen of phage display peptide library |
| DRACP01151 | SEQ ID NO 14 from EP1783140A3 | IHWRPWAR | 8 | Screen of phage display peptide library |
| DRACP01152 | SEQ ID NO 24 from EP1783140A3 | LFPLH | 5 | Screen of phage display peptide library |
| DRACP01153 | SEQ ID NO 21 from EP1783140A3 | PVVLFLH | 7 | Screen of phage display peptide library |
| DRACP01154 | SEQ ID NO 28 from EP1783140A3 | RWRP | 4 | Screen of phage display peptide library |
| DRACP01155 | SEQ ID NO 32 from EP1783140A3 | WRP | 3 | Screen of phage display peptide library |
This work is licensed under a Creative Commons Attribution 4.0 International License.