This work is licensed under a Creative Commons Attribution 4.0 International License.
| DRACP ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DRACP00197 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | 21 | Histone H2A |
| DRACP01828 | MB30 | GQVWEATATVNAIRGSVTPAVSQFNARTAD | 30 | Derived from the MPT63 secreted protein |
| DRACP01829 | TG20 | NHFTLKCPKTALTEPPTLAY | 20 | Derived from the SAG1 surface protein from the parasite Toxoplasma gondii |
| DRACP01830 | TG23 | TAGIKLTVPIEKFPVTTQTFWG | 22 | Derived from the SAG1 surface protein from the parasite Toxoplasma gondii |
| DRACP02551 | AMP 1A analogs1 | GFXGXKKXGXFXGXGKKXKKKK | 22 | Synthetic |
| DRACP02552 | AMP 1A analogs2 | GFXGXRXGXFXGXGRXRRRR | 20 | Synthetic |
| DRACP02553 | AMP 1A analogs3 | GFXGXXXGXFXGXGXXXXXX | 20 | Synthetic |
| DRACP02554 | AMP 1A analogs4 | GFXGXXXGXFXGXGXXXXXX | 20 | Synthetic |
| DRACP02555 | AMP 1A analogs5 | GFXGXXXGXFXGXGXXXXXX | 20 | Synthetic |
| DRACP02556 | AMP 1A analogs6 | GFXGXKXGXFXGXGKXKKKK | 20 | Synthetic |
| DRACP02557 | AMP 1A analogs7 | GFXGXRXGXFXGXGRXRRRR | 20 | Synthetic |
| DRACP02558 | AMP 1A analogs8 | GFXGXKXGXFXGXGKXKKKK | 20 | Synthetic |
| DRACP02559 | AMP 1A analogs9 | GFXGXKXGXFXGXGKXKKKK | 20 | Synthetic |
| DRACP02560 | AMP 1A analogs10 | GFXGXKXGXFXGXGKXKKKK | 20 | Synthetic |
| DRACP02561 | AMP 1A analogs11 | KKKKGFXGXKXGXFXGXGKX | 20 | Synthetic |
This work is licensed under a Creative Commons Attribution 4.0 International License.