This work is licensed under a Creative Commons Attribution 4.0 International License.
| DRACP ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DRACP01137 | CMAP-L-233 | KKKKFFMSFFFKKKF | 15 | Not available |
| DRACP01138 | CMAP-L-201 | KKKKFFSMSFFKKFF | 15 | Not available |
| DRACP01139 | CB1a, Cecropin-B1a | KWKVFKKIEKKWKVFKKIEKAGPKWKVFKKIEK | 33 | Not available |
| DRACP01141 | SEQ ID NO 19 from EP1783140A3 | ADGAPRPGAPLA | 12 | Screen of phage display peptide library |
| DRACP01142 | SEQ ID NO 17 from EP1783140A3 | APRPG | 5 | Screen of phage display peptide library |
| DRACP01143 | SEQ ID NO 6 from EP1783140A3 | ASSSYPLIHWRPWAR | 15 | Screen of phage display peptide library |
| DRACP01144 | SEQ ID NO 13 from EP1783140A3 | DRWRPALP | 8 | Screen of phage display peptide library |
| DRACP01145 | SEQ ID NO 5 from EP1783140A3 | DRWRPALPVVLFPLH | 15 | Screen of phage display peptide library |
| DRACP01146 | SEQ ID NO 33 from EP1783140A3 | HARPW | 5 | Screen of phage display peptide library |
| DRACP01147 | SEQ ID NO 34 from EP1783140A3 | HWAPW | 5 | Screen of phage display peptide library |
| DRACP01148 | SEQ ID NO 35 from EP1783140A3 | HWRAW | 5 | Screen of phage display peptide library |
| DRACP01149 | SEQ ID NO 29 from EP1783140A3 | HWRP | 4 | Screen of phage display peptide library |
| DRACP01150 | SEQ ID NO 16 from EP1783140A3 | HWRPW | 5 | Screen of phage display peptide library |
| DRACP01151 | SEQ ID NO 14 from EP1783140A3 | IHWRPWAR | 8 | Screen of phage display peptide library |
| DRACP01152 | SEQ ID NO 24 from EP1783140A3 | LFPLH | 5 | Screen of phage display peptide library |
| DRACP01153 | SEQ ID NO 21 from EP1783140A3 | PVVLFLH | 7 | Screen of phage display peptide library |
| DRACP01154 | SEQ ID NO 28 from EP1783140A3 | RWRP | 4 | Screen of phage display peptide library |
| DRACP01155 | SEQ ID NO 32 from EP1783140A3 | WRP | 3 | Screen of phage display peptide library |
| DRACP01156 | SEQ ID NO 30 from EP1783140A3 | WRPA | 4 | Screen of phage display peptide library |
| DRACP01157 | SEQ ID NO 31 from EP1783140A3 | WRPW | 4 | Screen of phage display peptide library |
| DRACP01161 | D-Glu-Fniii14 | TeATITGLEPGTEYTITVIAL | 21 | Not available |
| DRACP01162 | Not available | TEATITGLEPGTEYTITVIAL | 21 | Not available |
| DRACP01163 | hBD3-3 | GKCSTRGRKCCRRKK | 15 | Not available |
| DRACP01164 | hBD3-3 M1 | GKCSTRGRKCMRRKK | 15 | Not available |
| DRACP01165 | hBD3-3 M2 | GKCSTRGRKMCRRKK | 15 | Not available |
| DRACP01166 | PBP-1 | CLQKTPKQC | 9 | Not available |
| DRACP01167 | PBP-2 | CVRARTR | 7 | Not available |
| DRACP01168 | v6Pep-2 | CNEWQLKSC | 9 | Screen of phage display peptide library |
| DRACP01169 | v6Pep-1 | CNLNTIDTC | 9 | Screen of phage display peptide library |
| DRACP01170 | HDH-LGBP-A2 | WLWKAIWKLLK | 11 | Not available |
This work is licensed under a Creative Commons Attribution 4.0 International License.