This work is licensed under a Creative Commons Attribution 4.0 International License.
| DRACP ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DRACP00724 | Bombinin H-BO | IIGPVLGLIGKALGGLL | 17 | skin secretion of Oriental fire-bellied toad, Bombina orientalis |
| DRACP00725 | D Tachyplesin [C3,7,12,16Del] | kwfrvyrGiyrrr | 13 | Synthetic |
| DRACP00726 | Tachyplesin [C3,7,12,16Del] | KWFRVYRGIYRRR | 13 | Synthetic |
| DRACP00727 | Reverse D Tachyplesin [C3,7,12,16Del] | rrryiGryvrfwk | 13 | Synthetic |
| DRACP00728 | Reverse Tachyplesin [C3,7,12,16Del] | RRRYIGRYVRFWK | 13 | Synthetic |
| DRACP00729 | I-3 | LVKRFKKFFRKLKKSVLL | 18 | cationic host defense peptides |
| DRACP00730 | I-7 | LVRRFRRFFRRLRRSVLL | 18 | cationic host defense peptides |
| DRACP00731 | I-8 | VKRFKKFFLKLKSV | 14 | cationic host defense peptides |
| DRACP00732 | B1 | VKRFKKFFRKLKKSV | 15 | cationic host defense peptides |
| DRACP00733 | I-1 | VKRFKKFFRKLKKSVL | 16 | cationic host defense peptides |
| DRACP00734 | I-2 | VKRFKKFFRKLKKSVLL | 17 | cationic host defense peptides |
| DRACP00735 | I-9 | VKRFKLFFRKLKSV | 14 | cationic host defense peptides |
| DRACP00736 | I-11 | VRRFRLFFRRLRRSV | 15 | cationic host defense peptides |
| DRACP00736 | I-11 | VRRFRLFFRRLRRSV | 15 | cationic host defense peptides |
| DRACP00737 | I-10 | VRRFRRFFLRLRRSV | 15 | cationic host defense peptides |
| DRACP00738 | I-4 | VRRFRRFFRRLRRSV | 15 | cationic host defense peptides |
| DRACP00739 | I-5 | VRRFRRFFRRLRRSVL | 16 | cationic host defense peptides |
| DRACP00740 | I-6 | VRRFRRFFRRLRRSVLL | 17 | cationic host defense peptides |
| DRACP00741 | Tricyclon-A | GGTIFDCGESCFLGTCYTKGCSCGEWKLCYGTN | 33 | Viola odorata |
| DRACP00742 | MCoTI-II | GGVCPKILKKCRRDSDCPGACICRGNGYCGSGSD | 34 | Momordica cochinchinensis |
| DRACP00743 | MCoTI-I | GGVCPKILQRCRRDSDCPGACICRGNGYCGSGSD | 34 | Momordica cochinchinensis |
| DRACP00744 | Cyclotide cter-E | GIPCAESCVWIPCTVTALLGCSCKDKVCYLD | 31 | Clitoria ternatea |
| DRACP00745 | Cycloviolacin O3 | GIPCGESCVWIPCLTSAIGCSCKSKVCYRN | 30 | Viola odorata |
| DRACP00746 | Cyclotide cter-G | GLPCGESCVFIPCITTVVGCSCKNKVCYNN | 30 | Clitoria ternatea |
| DRACP00747 | Kalata-B13 | GLPVCGETCFGGTCNTPGCACDPWPVCTRD | 30 | Oldenlandia affinis |
| DRACP00748 | Kalata B7 [Y15S] | GLPVCGETCTLGTCSTQGCTCSWPICKRN | 29 | Synthetic |
| DRACP00749 | Cycloviolacin-O19 | GTLPCGESCVWIPCISSVVGCSCKSKVCYKD | 31 | Viola odorata |
| DRACP00750 | [D-Trp]CJ-15,208 | FpFw | 4 | Synthetic |
| DRACP00751 | CJ-15,208 | FpFW | 4 | Synthetic |
| DRACP00752 | temporin-ITa | FLGAIAQALTSLLGKL | 16 | skin secretions of the Italian stream frog Rana italica (Ranidae) |
This work is licensed under a Creative Commons Attribution 4.0 International License.