This work is licensed under a Creative Commons Attribution 4.0 International License.
| DRACP ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DRACP00770 | As-CATH4 | RRGLFKKLRRKIKKGFKKIFKRLPPVGVGVSIPLAGRR | 38 | Alligator sinensis |
| DRACP00776 | Phylloseptin-PHa | FLSLIPAAISAVSALANHF | 19 | Pithecopus hypochondrialis |
| DRACP00777 | Phylloseptin-PT | FLSLIPKIAGGIAALAKHL | 19 | Phyllomedusa baltea |
| DRACP00778 | Ilamycin B1 | XXLXAXX | 7 | Streptomyces atratus SCSIO ZH16 |
| DRACP00779 | Ilamycin B2 | XXLXAXX | 7 | Streptomyces atratus SCSIO ZH16 |
| DRACP00780 | Ilamycin C | XXLXAXX | 7 | Streptomyces atratus SCSIO ZH21 |
| DRACP00781 | Ilamycin D | XXLXAXX | 7 | Streptomyces atratus SCSIO ZH25 |
| DRACP00782 | Ilamycin E | XXLXAXX | 7 | Streptomyces atratus SCSIO ZH25 |
| DRACP00783 | Ilamycin F | XXLXAXX | 7 | Streptomyces atratus SCSIO ZH25 |
| DRACP00784 | Bacteriocin ASP-1 | FTVAXFI | 7 | Bacillus subtilis URID 12.1 |
| DRACP00786 | LfcinB (17-31)2 | FKARRWQWRMKKLGAFKARRWQWRMKKLGAKX | 32 | Bovine Lactoferricin |
| DRACP00787 | LfcinB (17-31)4 | FKARRWQWRMKKLGAFKARRWQWRMKKLGAKXC [Precursor of tetrameric peptide] | 33 | Bovine Lactoferricin |
| DRACP00788 | LfcinB (20–25)2 | RRWQWRRRWQWRKX | 14 | Bovine Lactoferricin |
| DRACP00789 | LfcinB (20–25)4 | RRWQWRRRWQWRKXC [Precursor of tetrameric peptide] | 15 | Bovine Lactoferricin |
| DRACP00790 | LfcinB (20–30)2 | RWQWRMKKLGRWQWRMKKLGKX | 22 | Bovine Lactoferricin |
| DRACP00791 | LfcinB (20–30)4 | RWQWRMKKLGRWQWRMKKLGKXC [Precursor of tetrameric peptide] | 23 | Bovine Lactoferricin |
| DRACP00792 | LfcinB (17-31) | FKARRWQWRMKKLGA | 15 | Bovine Lactoferricin |
| DRACP00793 | LfcinB (17-31)cyc | CFKARRWQWRMKKLGAXC | 18 | Bovine Lactoferricin |
| DRACP00794 | LfcinB (20–25) | RRWQWR | 6 | Bovine Lactoferricin |
| DRACP00795 | LfcinB (20–25)cyc | CRRWQWRXC | 9 | Bovine Lactoferricin |
| DRACP00796 | LfcinB (20–30) | RWQWRMKKLG | 10 | Bovine Lactoferricin |
| DRACP00797 | LfcinB (20–30)cyc | CRWQWRMKKLGXC | 13 | Bovine Lactoferricin |
| DRACP00800 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLVQ | 23 | Phyllomedusa hypochondrialis |
| DRACP00801 | Bombinin-BO1 | GIGSAILSAGKSIIKGLAKGLAEHF | 25 | Bombina orientalis |
| DRACP00802 | Bombinin-BO1 | GIGSAILSAGKSIIKGLAKGLA | 22 | skin secretion of Oriental fire-bellied toad, Bombina orientalis |
| DRACP00803 | Bombinin H-BO1 | IIGPVLGLVGKALGGLL | 17 | skin secretion of Oriental fire-bellied toad, Bombina orientalis |
| DRACP00804 | PSN-PC | FLSLIPKIATGIAALAKHL | 19 | Phyllomedusa camba |
| DRACP00805 | HD5 | ATCYCRTGRCATRESLSGVCEISGRLYRLCCR | 32 | Homo sapiens |
| DRACP00806 | Temporin-PE | FLPIVAKLLSGLL | 13 | Pelophylax kl.esculentus(Europe edible frog) |
| DRACP00812 | Brevinin-1DYa | FLSLALAALPKFLCLVFKKC | 20 | Rana dybowskii; Rana huanrenensis; Rana amurensis |
This work is licensed under a Creative Commons Attribution 4.0 International License.