This work is licensed under a Creative Commons Attribution 4.0 International License.
| DRACP ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DRACP00753 | Brevinin-1ITa | IVPFLLGMVPKLVCLITKKC | 20 | skin secretions of the Italian stream frog Rana italica (Ranidae) |
| DRACP00754 | [R4A,R18A]cGm | GCRALCYKQRCVTYCRGA | 18 | Redesigned Spider Peptide |
| DRACP00755 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DRACP00756 | [Y7W,K8R,Y14W]cGm | GCRRLCWRQRCVTWCRGR | 18 | Redesigned Spider Peptide |
| DRACP00757 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | 18 | Redesigned Spider Peptide |
| DRACP00758 | [DPLP]cGm | GCRRLCYKQRCVTYCRGpPR | 20 | Redesigned Spider Peptide |
| DRACP00759 | cGm | GCRRLCYKQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DRACP00760 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DRACP00761 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DRACP00762 | [C/U]cGm | GURRLUYKQRUVTYURGR | 18 | Redesigned Spider Peptide |
| DRACP00764 | [G1K,K8R]cGm | KCRRLCYRQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DRACP00765 | [G1K,L5Y,K8R]cGm | KCRRYCYRQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DRACP00766 | [C/U,G1K,L5Y,K8R]cGm | KURRYUYRQRUVTYURGR | 18 | Redesigned Spider Peptide |
| DRACP00768 | Gm | XCRRLCYKQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DRACP00769 | Gmred | XCRRLCYKQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DRACP00786 | LfcinB (17-31)2 | FKARRWQWRMKKLGAFKARRWQWRMKKLGAKX | 32 | Bovine Lactoferricin |
| DRACP00787 | LfcinB (17-31)4 | FKARRWQWRMKKLGAFKARRWQWRMKKLGAKXC [Precursor of tetrameric peptide] | 33 | Bovine Lactoferricin |
| DRACP00788 | LfcinB (20–25)2 | RRWQWRRRWQWRKX | 14 | Bovine Lactoferricin |
| DRACP00789 | LfcinB (20–25)4 | RRWQWRRRWQWRKXC [Precursor of tetrameric peptide] | 15 | Bovine Lactoferricin |
| DRACP00790 | LfcinB (20–30)2 | RWQWRMKKLGRWQWRMKKLGKX | 22 | Bovine Lactoferricin |
| DRACP00791 | LfcinB (20–30)4 | RWQWRMKKLGRWQWRMKKLGKXC [Precursor of tetrameric peptide] | 23 | Bovine Lactoferricin |
| DRACP00792 | LfcinB (17-31) | FKARRWQWRMKKLGA | 15 | Bovine Lactoferricin |
| DRACP00793 | LfcinB (17-31)cyc | CFKARRWQWRMKKLGAXC | 18 | Bovine Lactoferricin |
| DRACP00794 | LfcinB (20–25) | RRWQWR | 6 | Bovine Lactoferricin |
| DRACP00795 | LfcinB (20–25)cyc | CRRWQWRXC | 9 | Bovine Lactoferricin |
| DRACP00796 | LfcinB (20–30) | RWQWRMKKLG | 10 | Bovine Lactoferricin |
| DRACP00797 | LfcinB (20–30)cyc | CRWQWRMKKLGXC | 13 | Bovine Lactoferricin |
| DRACP00802 | Bombinin-BO1 | GIGSAILSAGKSIIKGLAKGLA | 22 | skin secretion of Oriental fire-bellied toad, Bombina orientalis |
| DRACP00803 | Bombinin H-BO1 | IIGPVLGLVGKALGGLL | 17 | skin secretion of Oriental fire-bellied toad, Bombina orientalis |
| DRACP00806 | Temporin-PE | FLPIVAKLLSGLL | 13 | Pelophylax kl.esculentus(Europe edible frog) |
This work is licensed under a Creative Commons Attribution 4.0 International License.