This work is licensed under a Creative Commons Attribution 4.0 International License.
| DRACP ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DRACP00740 | I-6 | VRRFRRFFRRLRRSVLL | 17 | cationic host defense peptides |
| DRACP00741 | Tricyclon-A | GGTIFDCGESCFLGTCYTKGCSCGEWKLCYGTN | 33 | Viola odorata |
| DRACP00742 | MCoTI-II | GGVCPKILKKCRRDSDCPGACICRGNGYCGSGSD | 34 | Momordica cochinchinensis |
| DRACP00743 | MCoTI-I | GGVCPKILQRCRRDSDCPGACICRGNGYCGSGSD | 34 | Momordica cochinchinensis |
| DRACP00744 | Cyclotide cter-E | GIPCAESCVWIPCTVTALLGCSCKDKVCYLD | 31 | Clitoria ternatea |
| DRACP00745 | Cycloviolacin O3 | GIPCGESCVWIPCLTSAIGCSCKSKVCYRN | 30 | Viola odorata |
| DRACP00746 | Cyclotide cter-G | GLPCGESCVFIPCITTVVGCSCKNKVCYNN | 30 | Clitoria ternatea |
| DRACP00747 | Kalata-B13 | GLPVCGETCFGGTCNTPGCACDPWPVCTRD | 30 | Oldenlandia affinis |
| DRACP00748 | Kalata B7 [Y15S] | GLPVCGETCTLGTCSTQGCTCSWPICKRN | 29 | Synthetic |
| DRACP00749 | Cycloviolacin-O19 | GTLPCGESCVWIPCISSVVGCSCKSKVCYKD | 31 | Viola odorata |
| DRACP00752 | temporin-ITa | FLGAIAQALTSLLGKL | 16 | skin secretions of the Italian stream frog Rana italica (Ranidae) |
| DRACP00753 | Brevinin-1ITa | IVPFLLGMVPKLVCLITKKC | 20 | skin secretions of the Italian stream frog Rana italica (Ranidae) |
| DRACP00754 | [R4A,R18A]cGm | GCRALCYKQRCVTYCRGA | 18 | Redesigned Spider Peptide |
| DRACP00755 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DRACP00756 | [Y7W,K8R,Y14W]cGm | GCRRLCWRQRCVTWCRGR | 18 | Redesigned Spider Peptide |
| DRACP00757 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | 18 | Redesigned Spider Peptide |
| DRACP00759 | cGm | GCRRLCYKQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DRACP00760 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DRACP00761 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DRACP00762 | [C/U]cGm | GURRLUYKQRUVTYURGR | 18 | Redesigned Spider Peptide |
| DRACP00763 | Cyclic Gomesin [PYA1G, C2,6,11,15SeCys] | GXRRLXYKQRXVTYXRGR | 18 | Synthetic |
| DRACP00764 | [G1K,K8R]cGm | KCRRLCYRQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DRACP00765 | [G1K,L5Y,K8R]cGm | KCRRYCYRQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DRACP00766 | [C/U,G1K,L5Y,K8R]cGm | KURRYUYRQRUVTYURGR | 18 | Redesigned Spider Peptide |
| DRACP00767 | Cyclic Gomesin [PYA1K;C2,6,11,15SeCys;L5Y;K8R] | KXRRYXYRQRXVTYXRGR | 18 | Synthetic |
| DRACP00768 | Gm | XCRRLCYKQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DRACP00769 | Gmred | XCRRLCYKQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DRACP00770 | As-CATH4 | RRGLFKKLRRKIKKGFKKIFKRLPPVGVGVSIPLAGRR | 38 | Alligator sinensis |
| DRACP00771 | Lavracin | WDPYFAGVKKLTKAILAVRA | 20 | Synthetic |
| DRACP00772 | Lavracin [D2G,P3K,Y4F] | WGKFFAGVKKLTKAILAVRA | 20 | Synthetic |
This work is licensed under a Creative Commons Attribution 4.0 International License.