This work is licensed under a Creative Commons Attribution 4.0 International License.
| DRACP ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DRACP00048 | Temporin-1Tl | FVQWFSKFLGRIL | 13 | Rana temporaria |
| DRACP00095 | MRP | AIGSILGALAKGLPTLISWIKNR | 23 | Rana tagoi |
| DRACP00125 | Psychrophilin D (1) | LW | 2 | Anthranilic acid |
| DRACP00134 | Laxaphycin B | AXQNXXXPLXXVX | 13 | Terrestrial blue-green alga Anabaena laxa or the marine cyanobacterium Lyngbya Majuscula |
| DRACP00135 | Laxaphycin A | XXXFLXXLGXX | 11 | Terrestrial blue-green alga Anabaena laxa or the marine cyanobacterium Lyngbya Majuscula |
| DRACP00172 | Magainin B | GIGKFLHAAKKFAKAFVAEIMNS | 23 | Xenopus laevis |
| DRACP00173 | Magainin G | GIGKFLHSAKKFAKAFVAEIMNS | 23 | Xenopus laevis |
| DRACP00174 | Magainin A | AIGKFLHSAKKFGKAFVGEIMNS | 23 | Xenopus laevis |
| DRACP00175 | Z44 | ALSKALSKALSKALSKALSKALSK | 24 | Xenopus laevis |
| DRACP00176 | Z24 | ALSKALSKALSKALSKALSKALSK | 24 | Xenopus laevis |
| DRACP00177 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | 23 | Xenopus laevis |
| DRACP00196 | Brevinin-2R | KLKNFAIGVAQSLLNKASCKLSGQC | 25 | Pelophylax ridibundus (Marsh frog) (Rana ridibunda) |
| DRACP00197 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | 21 | Histone H2A |
| DRACP00218 | LfcinB | FKCRRWQWRMKK | 12 | Bovine lactoferrin (Lf-B) |
| DRACP00281 | LTX-302 | WKKWXKKWK | 9 | Synthetic |
| DRACP00282 | LTX-315 | KKWWKKWXK | 9 | Synthetic |
| DRACP00283 | LTX-318 | XXWXXXWWX | 9 | Synthetic |
| DRACP00434 | c1 | KKWXWKK | 7 | Synthetic |
| DRACP00435 | c5 | KKWXWKK | 7 | Synthetic |
| DRACP00436 | c3 | KKXWKK | 6 | Synthetic |
| DRACP00437 | c7 | KKXWKK | 6 | Synthetic |
| DRACP00438 | c4 | KWXKK | 5 | Synthetic |
| DRACP00439 | c8 | KWXKK | 5 | Synthetic |
| DRACP00440 | c2 | KWXWKK | 6 | Synthetic |
| DRACP00441 | c6 | KWXWKK | 6 | Synthetic |
| DRACP00444 | 9R | RRRRRNWMWC | 10 | Nullomer derived anticancer peptides (NulloPs): |
| DRACP00445 | 9S1R | RRRRRWCMNW | 10 | Nullomer derived anticancer peptides (NulloPs): |
| DRACP00446 | Adenoregulin (DRS B2) | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV | 33 | South American frog Phyllomedusa bicolor |
| DRACP00450 | Cupiennin-1a | GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME | 35 | Cupiennius salei |
| DRACP00481 | Cecropin A (2-8) + Melittin (6-9) | WKLFKKILKVL | 11 | Synthetic |
This work is licensed under a Creative Commons Attribution 4.0 International License.