This work is licensed under a Creative Commons Attribution 4.0 International License.
| DRACP ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DRACP00456 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | 33 | Epinephelus nebulosus |
| DRACP00457 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | 21 | Epinephelus nebulosus |
| DRACP00458 | Temporin-1CEa LK2(5) | FKDLKKIANIINSIFKK | 17 | Synthetic construct |
| DRACP00459 | Temporin-1CEa LK3 | FKKLKKIANIINSIFKK | 17 | Synthetic construct |
| DRACP00460 | Temporin-1CEa LK1 | FVDLKKIANIINSIFKK | 17 | Synthetic construct |
| DRACP00461 | Temporin-1CEa LK2(6) | FVKLKKIANIINSIFKK | 17 | Synthetic construct |
| DRACP00462 | Temporin-1CEa LK2(6)AN(2L) | FVKLKKILNIILSIFKK | 17 | Synthetic construct |
| DRACP00463 | Temporin-1CEa LK2(6)A(L) | FVKLKKILNIINSIFKK | 17 | Synthetic construct |
| DRACP00464 | Sungsanpin | GFGSKPIDSFGLSWL | 15 | Streptomyces |
| DRACP00465 | NRC-16 | GWKKWLRKGAKHLGQAAIK | 19 | Synthetic |
| DRACP00466 | TsAP-2 (T. serrulatus antimicrobial peptide 2) | FLGMIPGLIGGLISAFK | 17 | Tityus serrulatus (Brazilian yellow scorpion) |
| DRACP00467 | TsAP-1 (T. serrulatus antimicrobial peptide 1) | FLSLIPSLVGGSISAFK | 17 | Tityus serrulatus (Brazilian yellow scorpion) |
| DRACP00468 | Melittin | GIGAVLKVLTTGLPALISWIKRKRQQ | 26 | Apis mellifera (Honeybee) |
| DRACP00474 | Bac2a [L2R][A3W][A11R] | RRWRIVVIRVRR | 12 | Synthetic |
| DRACP00475 | C -C8 | RWRWRWX | 7 | Synthetic |
| DRACP00476 | Drosocin-1 | GKPRPYSPRPTSHPRPIRV | 19 | Drosophila melanogaster; Drosophila simulans |
| DRACP00477 | KilerFLIP-E | YGRKKRRQRRRREADFFWSLCTA | 23 | The C-terminal domain of c-FLIP |
| DRACP00478 | Short α-helical peptides | GIIKKIIKKI | 10 | Alpha-helical proteins |
| DRACP00479 | Short α-helical peptides | GIIKKIIKKIIKKI | 14 | Alpha-helical proteins |
| DRACP00480 | Short α-helical peptides | GIIKKIIKKIIKKIIKKI | 18 | Alpha-helical proteins |
| DRACP00481 | Cecropin A (2-8) + Melittin (6-9) | WKLFKKILKVL | 11 | Synthetic |
| DRACP00485 | Dermaseptin S4 [M4D][N20D] | ALWDTLLKKVLKAAAKAALDAVLVGANA | 28 | Synthetic |
| DRACP00486 | Dermaseptin S4 (1-16)[M4K] | ALWKTLLKKVLKAAAK | 16 | Synthetic |
| DRACP00487 | Dermaseptin S4 [M4K][N20K] | ALWKTLLKKVLKAAAKAALKAVLVGANA | 28 | Synthetic |
| DRACP00488 | Dermaseptin S4 [M4K] | ALWKTLLKKVLKAAAKAALNAVLVGANA | 28 | Synthetic |
| DRACP00489 | Dermaseptin S4 (5-28) | TLLKKVLKAAAKAALNAVLVGANA | 24 | Synthetic |
| DRACP00490 | cyclosaplin | RLGDGCTR | 8 | somatic seedlings of sandalwood |
| DRACP00491 | Trichoplaxin | FFGRLKSVWSAVKHGWKAAKSR | 22 | Trichoplax adhaerens |
| DRACP00492 | APTSTAT3-9R | HGFQWPGSWTWENGKWTWKGAYQFLKGGGGSRRRRRRRRR | 40 | Synthetic |
| DRACP00493 | Pexiganan | GIGKFLKKAKKFGKAFVKILKK | 22 | Analog of magainin 2 |
This work is licensed under a Creative Commons Attribution 4.0 International License.