This work is licensed under a Creative Commons Attribution 4.0 International License.
| DRACP ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DRACP00494 | LL 37 | [LL-37, 37 aa] | 37 | Also known human cathelicidin |
| DRACP00495 | Cathelicidin-RC1 | KKCKFFCKVKKKIKSIGFQIPIVSIPFK | 28 | Lithobates catesbeiana |
| DRACP00496 | LTX-328 | KAQXQKQAW | 9 | Synthetic |
| DRACP00497 | Chrysophsin-1 | FFGWLIKGAIHAGKAIHGLIHRRRH | 25 | Red sea bream |
| DRACP00498 | T Peptide | TKPRKTKPRKTKPRKTKPR | 19 | Tuftsin derivative |
| DRACP00499 | mt_T18S/L22 W/P27A | ESFSDWWKLLAE | 12 | MDM2 |
| DRACP00500 | mt_S20A/L22 W/P27A | ETFADWWKLLAE | 12 | MDM2 |
| DRACP00501 | mt_L22 W/P27A | ETFSDWWKLLAE | 12 | MDM2 |
| DRACP00502 | mt_E17L/L22 W/P27A | LTFSDWWKLLAE | 12 | MDM2 |
| DRACP00503 | Latarcin-1 | SMWSGMWRRKLKKLRNALKKKLKGE | 25 | Lachesana tarabaevi |
| DRACP00504 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | 27 | Synthetic |
| DRACP00505 | C7A-Δ | KILRGVAKKIMRTFLRRILTGKK | 23 | Synthetic |
| DRACP00506 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | 27 | Synthetic |
| DRACP00507 | Toxin F-VIII | MICYSHKTPQPSATITCEEKTCYKKSVRKLPAIVAGRGCGCPSKEMLVAIHCCRSDKCNE | 60 | venom of the Eastern green mamba, Dendroaspis angusticeps (Elapidae) |
| DRACP00508 | Toxin C13S1C1 | RICYSHKLLQAKTTKTCEENSCYKRSLPKIPLIIIGRGCGCPLTLPFLRIKCCTSDKCN | 59 | venom of the Eastern green mamba, Dendroaspis angusticeps (Elapidae) |
| DRACP00509 | 3-OH-C16-KKKK | KKKK | 4 | Synthetic |
| DRACP00510 | C16-KKKK | KKKK | 4 | Synthetic |
| DRACP00511 | Hymenochirin-1Pa | LKLSPKTKDTLKKVLKGAIKGAIAIASMA | 29 | skin secretions of the frog Pseudhymenochirus merlini (Pipidae) |
| DRACP00512 | [D9K]Hymenochirin-1Pa | LKLSPKTKKTLKKVLKGAIKGAIAIASMA | 29 | skin secretions of the frog Pseudhymenochirus merlini (Pipidae) |
| DRACP00513 | [D9k]Hymenochirin-1Pa | LKLSPKTKkTLKKVLKGAIKGAIAIASMA | 29 | skin secretions of the frog Pseudhymenochirus merlini (Pipidae) |
| DRACP00514 | Mastoparan | INLKALAALAKKIL | 14 | Vespula lewisii |
| DRACP00515 | Ps-2Pa | GIFPIFAKLLGKVIKVASSLISKGRTE | 27 | skin secretions of the frog Pseudhymenochirus merlini (Pipidae) |
| DRACP00516 | Ps-1Pb | IKIPSFFRNILKKVGKEAVSLIAGALKQS | 29 | skin secretions of the frog Pseudhymenochirus merlini (Pipidae) |
| DRACP00517 | B1-Ala | VKRFKKFFRKLKKAV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B1 |
| DRACP00518 | B1-Asp | VKRFKKFFRKLKKDV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B3 |
| DRACP00519 | B1-Glu | VKRFKKFFRKLKKEV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B3 |
| DRACP00520 | B1-Phe | VKRFKKFFRKLKKFV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B1 |
| DRACP00521 | B1-Gly | VKRFKKFFRKLKKGV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B2 |
| DRACP00522 | B1-His | VKRFKKFFRKLKKHV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B3 |
| DRACP00523 | B1-Lys | VKRFKKFFRKLKKKV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B3 |
This work is licensed under a Creative Commons Attribution 4.0 International License.