This work is licensed under a Creative Commons Attribution 4.0 International License.
| DRACP ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DRACP00181 | C7S/NK27-COOH | KILRGVSKKIMRTFLRRISKDILTGKK | 27 | Synthetic |
| DRACP00182 | NK23a | KISKKIMRTFLRRISKDILTGKK | 23 | Synthetic |
| DRACP00183 | Gramicidin S | VXLfPVXLfP | 10 | Bacillus brevis |
| DRACP00185 | Dermaseptin-L1 | GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS | 32 | skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae) |
| DRACP00186 | Phylloseptin-L1 | LLGMIPLAISAISALSKL | 18 | skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae) |
| DRACP00187 | Arenicin-1 | RWCVYAYVRVRGVLVRYRRCW | 21 | Arenicola marina |
| DRACP00196 | Brevinin-2R | KLKNFAIGVAQSLLNKASCKLSGQC | 25 | Pelophylax ridibundus (Marsh frog) (Rana ridibunda) |
| DRACP00204 | Crotamine (1–9,38–42) | YKQCHKKGGKKGSG | 14 | Synthetic |
| DRACP00205 | Brevinin-1BLa | FLPAIVGAAAKFLPKIFCAISKKC | 24 | North America, leopard frog, Lithobates blairi |
| DRACP00206 | Brevinin-1BLc | FLPIIAGIAAKFLPKIFCTISKKC | 24 | North America, leopard frog, Lithobates blairi |
| DRACP00207 | Brevinin-1Ya | FLPVIAGVAANFLPKLFCAISKKC | 24 | North America, leopard frog, Lithobates blairi |
| DRACP00208 | Brevinin-1Yb | FLPIIAGAAAKVVQKIFCAISKKC | 24 | North America, leopard frog, Lithobates blairi |
| DRACP00209 | Brevinin-1Yc | FLPIIAGAAAKVVEKIFCAISKKC | 24 | North America, leopard frog, Lithobates blairi |
| DRACP00210 | Ranatuerin-2Ya | GLMDTIKGVAKTVAASWLDKLKCKITGC | 28 | North America, leopard frog, Lithobates yavapaiensis |
| DRACP00220 | Polybia-MPI [L14L-S] | IDWKKLLDAAKQIX | 14 | Synthetic |
| DRACP00227 | Latarcin-5 | GFFGKMKEYFKKFGASFKRRFANLKKRL | 28 | Lachesana tarabaevi |
| DRACP00229 | P18 | KWKLFKKIPKFLHLAKKF | 18 | Synthetic |
| DRACP00236 | Psyle A | GIACGESCVFLGCFIPGCSCKSKVCYFN | 28 | Micronesian Plant Psychotria leptothyrsa |
| DRACP00237 | Psyle E | GVIPCGESCVFIPCISSVLGCSCKNKVCYRD | 31 | Micronesian Plant Psychotria leptothyrsa |
| DRACP00238 | Psyle C | KLCGETCFKFKCYTPGCSCSYPFCK | 25 | Micronesian Plant Psychotria leptothyrsa |
| DRACP00239 | Callyaerin E | LPFFPPVXPIIG | 12 | Callyspongia aerizusa |
| DRACP00240 | Callyaerin F | VPVFPXPLF | 9 | Callyspongia aerizusa |
| DRACP00241 | Callyaerin D | IIFPXPLXPINAI | 13 | Callyspongia aerizusa |
| DRACP00242 | Callyaerin H | VPVFPPLXPI | 10 | Callyspongia aerizusa |
| DRACP00243 | Callyaerin G | LPPPPLXPFFF | 11 | Callyspongia aerizusa |
| DRACP00246 | R7 | RRRRRRR | 7 | Synthetic |
| DRACP00257 | Ranatuerin-2Lb | GILSSIKGVAKGVAKNVAAQLLDTLKCKITGC | 32 | Rana luteiventris; Rana pretiosa |
| DRACP00259 | Oncocin [R15,19Orn][I16Tle] | VDKPPYLPRPRPPRXXYNX | 19 | Synthetic |
| DRACP00260 | Oncocin [P13Hyp][R15Hyp][R19Orn] | VDKPPYLPRPRPXRXIYNX | 19 | Synthetic |
| DRACP00261 | Oncocin [P13Hyp,R15Hyp,I16Tle,R19Orn] | VDKPPYLPRPRPXRXXYNX | 19 | Synthetic |
This work is licensed under a Creative Commons Attribution 4.0 International License.