This work is licensed under a Creative Commons Attribution 4.0 International License.
| DRACP ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DRACP00456 | Pardaxin-1 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | 33 | Epinephelus nebulosus |
| DRACP00457 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | 21 | Epinephelus nebulosus |
| DRACP00466 | TsAP-2 (T. serrulatus antimicrobial peptide 2) | FLGMIPGLIGGLISAFK | 17 | Tityus serrulatus (Brazilian yellow scorpion) |
| DRACP00467 | TsAP-1 (T. serrulatus antimicrobial peptide 1) | FLSLIPSLVGGSISAFK | 17 | Tityus serrulatus (Brazilian yellow scorpion) |
| DRACP00468 | Melittin | GIGAVLKVLTTGLPALISWIKRKRQQ | 26 | Apis mellifera (Honeybee) |
| DRACP00469 | BP16 | KKLFKKILKKL | 11 | Synthetic |
| DRACP00470 | BP81 | LKLFKKILKFL | 11 | Synthetic |
| DRACP00471 | BP105 | LKLFKKILKYL | 11 | Synthetic |
| DRACP00472 | BP307 | RRLFRRILRYL | 11 | Synthetic |
| DRACP00473 | BP325 | CLBKKLFKKILKKL | 14 | Synthetic |
| DRACP00493 | Pexiganan | GIGKFLKKAKKFGKAFVKILKK | 22 | Analog of magainin 2 |
| DRACP00494 | LL 37 | [LL-37, 37 aa] | 37 | Also known human cathelicidin |
| DRACP00496 | LTX-328 | KAQXQKQAW | 9 | Synthetic |
| DRACP00497 | Chrysophsin-1 | FFGWLIKGAIHAGKAIHGLIHRRRH | 25 | Red sea bream |
| DRACP00504 | C7A | KILRGVAKKIMRTFLRRISKDILTGKK | 27 | Synthetic |
| DRACP00505 | C7A-Δ | KILRGVAKKIMRTFLRRILTGKK | 23 | Synthetic |
| DRACP00506 | C7A-D21K | KILRGVAKKIMRTFLRRISKKILTGKK | 27 | Synthetic |
| DRACP00507 | Toxin F-VIII | MICYSHKTPQPSATITCEEKTCYKKSVRKLPAIVAGRGCGCPSKEMLVAIHCCRSDKCNE | 60 | venom of the Eastern green mamba, Dendroaspis angusticeps (Elapidae) |
| DRACP00508 | Toxin C13S1C1 | RICYSHKLLQAKTTKTCEENSCYKRSLPKIPLIIIGRGCGCPLTLPFLRIKCCTSDKCN | 59 | venom of the Eastern green mamba, Dendroaspis angusticeps (Elapidae) |
| DRACP00511 | Hymenochirin-1Pa | LKLSPKTKDTLKKVLKGAIKGAIAIASMA | 29 | skin secretions of the frog Pseudhymenochirus merlini (Pipidae) |
| DRACP00512 | [D9K]Hymenochirin-1Pa | LKLSPKTKKTLKKVLKGAIKGAIAIASMA | 29 | skin secretions of the frog Pseudhymenochirus merlini (Pipidae) |
| DRACP00513 | [D9k]Hymenochirin-1Pa | LKLSPKTKkTLKKVLKGAIKGAIAIASMA | 29 | skin secretions of the frog Pseudhymenochirus merlini (Pipidae) |
| DRACP00515 | Ps-2Pa | GIFPIFAKLLGKVIKVASSLISKGRTE | 27 | skin secretions of the frog Pseudhymenochirus merlini (Pipidae) |
| DRACP00516 | Ps-1Pb | IKIPSFFRNILKKVGKEAVSLIAGALKQS | 29 | skin secretions of the frog Pseudhymenochirus merlini (Pipidae) |
| DRACP00517 | B1-Ala | VKRFKKFFRKLKKAV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B1 |
| DRACP00518 | B1-Asp | VKRFKKFFRKLKKDV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B3 |
| DRACP00519 | B1-Glu | VKRFKKFFRKLKKEV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B3 |
| DRACP00520 | B1-Phe | VKRFKKFFRKLKKFV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B1 |
| DRACP00521 | B1-Gly | VKRFKKFFRKLKKGV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B2 |
| DRACP00522 | B1-His | VKRFKKFFRKLKKHV | 15 | Cathelicidin-BF15 C-terminal amidated derivative B3 |
This work is licensed under a Creative Commons Attribution 4.0 International License.