This work is licensed under a Creative Commons Attribution 4.0 International License.
| DRACP ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DRACP00192 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | 37 | Hyalophora Cecropia(silkmoth) |
| DRACP00193 | Cecropin B | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL | 35 | Chinese oak silk moth |
| DRACP00194 | Pep1 | FKCRRWQWRMKKLGAPSITCVR | 22 | Bovine lactoferrin (Lf-B) |
| DRACP00195 | mPep1 | RKAFRWAWRMLKKAAPSITCVR | 22 | Bovine lactoferrin (Lf-B) |
| DRACP00196 | Brevinin-2R | KLKNFAIGVAQSLLNKASCKLSGQC | 25 | Pelophylax ridibundus (Marsh frog) (Rana ridibunda) |
| DRACP00197 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | 21 | Histone H2A |
| DRACP00200 | PST13-RK | KKKFPWWWPFKKK | 13 | Derivative of tritrpticin |
| DRACP00201 | di-PST13-RK-C | KKKFPWWWPFKKKCKKKFPWWWPFKKKC | 28 | Derivative of tritrpticin |
| DRACP00202 | Tritrpticin | VRRFPWWWPFLRR | 13 | Derivative of tritrpticin |
| DRACP00217 | Cathelicidin-1 (8-26), CATH-1 (8-26), Fowlicidin-1 (8-26) | LVIRTVIAGYNLYRAIKKK | 19 | Synthetic |
| DRACP00218 | LfcinB | FKCRRWQWRMKK | 12 | Bovine lactoferrin (Lf-B) |
| DRACP00219 | KW5 | KAAKKAAKAAKKAAKAAKKAA | 21 | Bovine lactoferrin (Lf-B) |
| DRACP00231 | Camel | KWKLFKKIGAVLKVL | 15 | Ceropin-Melittin hybrid |
| DRACP00232 | Ceropin | MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG | 63 | Musca domestica |
| DRACP00262 | Buforin II | TRSSRAGLQFPVGRVHRLLRK | 21 | Bufo Bufo Gargarizans |
| DRACP00263 | Citropin1.1 | GLFDVIKKVASVIGGL | 16 | Australian blue mountains tree frog, Litoria citropa |
| DRACP00264 | Demegen P-113 | AKRHHGYKRKFH | 12 | Amphibian skin peptide |
| DRACP00265 | OmigaNAn MBI-226 | ILRWPWWPWRRK | 12 | Helical peptide with a predominance of one or more amino acids tryptophane-rich |
| DRACP00266 | PexigaNAn MSI-78 | GIGKFLKKAKKFGKAFVKILKK | 22 | Helical peptide with a predominance of one or more amino acids tryptophane-rich |
| DRACP00267 | Protegrin 1 | RGGRLCYCRRRFCVCVGR | 18 | Alpha helical peptide without cysteines |
| DRACP00268 | Temporin A | FLPLIGRVLSGIL | 13 | Frog Rana temporaria |
| DRACP00281 | LTX-302 | WKKWXKKWK | 9 | Synthetic |
| DRACP00282 | LTX-315 | KKWWKKWXK | 9 | Synthetic |
| DRACP00283 | LTX-318 | XXWXXXWWX | 9 | Synthetic |
| DRACP00319 | Cationic Amphiphilic | GIIKKIIIKKI | 11 | AMP |
| DRACP00320 | Cationic Amphiphilic | GIIKKIIIKKIIIKKI | 16 | AMP |
| DRACP00321 | Cationic Amphiphilic | GIIKKIIIKKIIIKKIIIKKI | 21 | AMP |
| DRACP00323 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | 25 | Pleurocidin-family |
| DRACP00340 | MAC1/2 | AFGMALKLLKKVL | 13 | Synthetic |
| DRACP00341 | MAC1/26 | GFGMAXKLLKKVL | 13 | Synthetic |
This work is licensed under a Creative Commons Attribution 4.0 International License.