| DRACP00192 |
Cecropin A |
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK |
37 |
Hyalophora Cecropia(silkmoth) |
| DRACP00193 |
Cecropin B |
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL |
35 |
Chinese oak silk moth |
| DRACP00194 |
Pep1 |
FKCRRWQWRMKKLGAPSITCVR |
22 |
Bovine lactoferrin (Lf-B) |
| DRACP00195 |
mPep1 |
RKAFRWAWRMLKKAAPSITCVR |
22 |
Bovine lactoferrin (Lf-B) |
| DRACP00196 |
Brevinin-2R |
KLKNFAIGVAQSLLNKASCKLSGQC |
25 |
Pelophylax ridibundus (Marsh frog) (Rana ridibunda) |
| DRACP00197 |
Buforin IIb |
RAGLQFPVGRLLRRLLRRLLR |
21 |
Histone H2A |
| DRACP00200 |
PST13-RK |
KKKFPWWWPFKKK |
13 |
Derivative of tritrpticin |
| DRACP00201 |
di-PST13-RK-C |
KKKFPWWWPFKKKCKKKFPWWWPFKKKC |
28 |
Derivative of tritrpticin |
| DRACP00202 |
Tritrpticin |
VRRFPWWWPFLRR |
13 |
Derivative of tritrpticin |
| DRACP00217 |
Cathelicidin-1 (8-26), CATH-1 (8-26), Fowlicidin-1 (8-26) |
LVIRTVIAGYNLYRAIKKK |
19 |
Synthetic |
| DRACP00218 |
LfcinB |
FKCRRWQWRMKK |
12 |
Bovine lactoferrin (Lf-B) |
| DRACP00219 |
KW5 |
KAAKKAAKAAKKAAKAAKKAA |
21 |
Bovine lactoferrin (Lf-B) |
| DRACP00231 |
Camel |
KWKLFKKIGAVLKVL |
15 |
Ceropin-Melittin hybrid |
| DRACP00232 |
Ceropin |
MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG |
63 |
Musca domestica |
| DRACP00262 |
Buforin II |
TRSSRAGLQFPVGRVHRLLRK |
21 |
Bufo Bufo Gargarizans |
| DRACP00263 |
Citropin1.1 |
GLFDVIKKVASVIGGL |
16 |
Australian blue mountains tree frog, Litoria citropa |
| DRACP00264 |
Demegen P-113 |
AKRHHGYKRKFH |
12 |
Amphibian skin peptide |
| DRACP00265 |
OmigaNAn MBI-226 |
ILRWPWWPWRRK |
12 |
Helical peptide with a predominance of one or more amino acids tryptophane-rich |
| DRACP00266 |
PexigaNAn MSI-78 |
GIGKFLKKAKKFGKAFVKILKK |
22 |
Helical peptide with a predominance of one or more amino acids tryptophane-rich |
| DRACP00267 |
Protegrin 1 |
RGGRLCYCRRRFCVCVGR |
18 |
Alpha helical peptide without cysteines |
| DRACP00268 |
Temporin A |
FLPLIGRVLSGIL |
13 |
Frog Rana temporaria |
| DRACP00281 |
LTX-302 |
WKKWXKKWK |
9 |
Synthetic |
| DRACP00282 |
LTX-315 |
KKWWKKWXK |
9 |
Synthetic |
| DRACP00283 |
LTX-318 |
XXWXXXWWX |
9 |
Synthetic |
| DRACP00319 |
Cationic Amphiphilic |
GIIKKIIIKKI |
11 |
AMP |
| DRACP00320 |
Cationic Amphiphilic |
GIIKKIIIKKIIIKKI |
16 |
AMP |
| DRACP00321 |
Cationic Amphiphilic |
GIIKKIIIKKIIIKKIIIKKI |
21 |
AMP |
| DRACP00323 |
NRC-07 |
RWGKWFKKATHVGKHVGKAALTAYL |
25 |
Pleurocidin-family |
| DRACP00340 |
MAC1/2 |
AFGMALKLLKKVL |
13 |
Synthetic |
| DRACP00341 |
MAC1/26 |
GFGMAXKLLKKVL |
13 |
Synthetic |