This work is licensed under a Creative Commons Attribution 4.0 International License.
| DRACP ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DRACP00185 | Dermaseptin-L1 | GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS | 32 | skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae) |
| DRACP00186 | Phylloseptin-L1 | LLGMIPLAISAISALSKL | 18 | skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae) |
| DRACP00187 | Arenicin-1 | RWCVYAYVRVRGVLVRYRRCW | 21 | Arenicola marina |
| DRACP00188 | vibi G | GTFPCGESCVFIPCLTSAIGCSCKSKVCYKN | 31 | V. biflora |
| DRACP00189 | vibi H | GLLPCAESCVYIPCLTTVIGCSCKSKVCYKN | 31 | V. biflora |
| DRACP00190 | vibi E | GIPCAESCVWIPCTVTALIGCGCSNKVCYN | 30 | V. biflora |
| DRACP00191 | vibi D | GLPVCGETCFGGRCNTPGCTCSYPICTRN | 29 | V. biflora |
| DRACP00192 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | 37 | Hyalophora Cecropia(silkmoth) |
| DRACP00193 | Cecropin B | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL | 35 | Chinese oak silk moth |
| DRACP00194 | Pep1 | FKCRRWQWRMKKLGAPSITCVR | 22 | Bovine lactoferrin (Lf-B) |
| DRACP00195 | mPep1 | RKAFRWAWRMLKKAAPSITCVR | 22 | Bovine lactoferrin (Lf-B) |
| DRACP00196 | Brevinin-2R | KLKNFAIGVAQSLLNKASCKLSGQC | 25 | Pelophylax ridibundus (Marsh frog) (Rana ridibunda) |
| DRACP00197 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | 21 | Histone H2A |
| DRACP00198 | a5 | KAQIRAMECNIL | 12 | Cyclin B (285-296) |
| DRACP00199 | Tat-a5 | KAQIRAMECNILGRKKRRQRRR | 22 | HIV-Tat (49-57) |
| DRACP00200 | PST13-RK | KKKFPWWWPFKKK | 13 | Derivative of tritrpticin |
| DRACP00201 | di-PST13-RK-C | KKKFPWWWPFKKKCKKKFPWWWPFKKKC | 28 | Derivative of tritrpticin |
| DRACP00202 | Tritrpticin | VRRFPWWWPFLRR | 13 | Derivative of tritrpticin |
| DRACP00203 | PNC-28 | ETFSDLWKLL | 10 | Antennapedia |
| DRACP00204 | Crotamine (1–9,38–42) | YKQCHKKGGKKGSG | 14 | Synthetic |
| DRACP00205 | Brevinin-1BLa | FLPAIVGAAAKFLPKIFCAISKKC | 24 | North America, leopard frog, Lithobates blairi |
| DRACP00206 | Brevinin-1BLc | FLPIIAGIAAKFLPKIFCTISKKC | 24 | North America, leopard frog, Lithobates blairi |
| DRACP00207 | Brevinin-1Ya | FLPVIAGVAANFLPKLFCAISKKC | 24 | North America, leopard frog, Lithobates blairi |
| DRACP00208 | Brevinin-1Yb | FLPIIAGAAAKVVQKIFCAISKKC | 24 | North America, leopard frog, Lithobates blairi |
| DRACP00209 | Brevinin-1Yc | FLPIIAGAAAKVVEKIFCAISKKC | 24 | North America, leopard frog, Lithobates blairi |
| DRACP00210 | Ranatuerin-2Ya | GLMDTIKGVAKTVAASWLDKLKCKITGC | 28 | North America, leopard frog, Lithobates yavapaiensis |
| DRACP00211 | Brevinin-1 CEa | FLIGMTQGLICLITRKC | 17 | skin of the Chinese brown frog, Rana chensinensis |
| DRACP00212 | Temporin-CEa | FVDLKKIANIINSIF | 15 | skin of the Chinese brown frog, Rana chensinensis |
| DRACP00213 | Temporin-CEb | ILPILSLIGGLL | 12 | skin of the Chinese brown frog, Rana chensinensis |
| DRACP00214 | Chensinin-1 | SAVGRHGRRFGLRKHRKH | 18 | skin of the Chinese brown frog, Rana chensinensis |
This work is licensed under a Creative Commons Attribution 4.0 International License.