This work is licensed under a Creative Commons Attribution 4.0 International License.
| DRACP ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DRACP00993 | Hyen C | GTHPCQETCVTSTRCSTQGCHCNWPICFKN | 30 | medicinal herb Hybanthus enneaspermus |
| DRACP00994 | Hyen E | GVPCGESCVYIPCFTGIINCSCRDKVCYNN | 30 | medicinal herb Hybanthus enneaspermus |
| DRACP00995 | Hyen M | SIPCAESCVWIPCTVTALLGCSCSDKVCYN | 30 | medicinal herb Hybanthus enneaspermus |
| DRACP00996 | Figainin 2 | FLGAILKIGHALAKTVLPMVTNAFKPKQ | 28 | Boana raniceps |
| DRACP00998 | Kassinatuerin-3 | FIQHLIPLIPHAIQGIKDIF | 20 | Skin Secretion of the African Frog, Kassina senegalensis |
| DRACP00999 | Anoplin [T8Beta-Ala] | GLLKRIKXLL | 10 | Synthetic |
| DRACP01000 | Anoplin [G1Beta-Ala] | XLLKRIKTLL | 10 | Synthetic |
| DRACP01001 | Desmethoxymajusculamide C | XXGXGXXXA | 9 | Lyngbya majuscula |
| DRACP01002 | Linear Desmethoxymajusculamide C | XXGXGXXXA | 9 | Synthetic |
| DRACP01003 | Ovalbumin (277-287)[V5R, P8R, K11I] | RKIKRYLRRMI | 11 | Synthetic |
| DRACP01004 | Ovalbumin (277-287) | RKIKVYLPRMK | 11 | Synthetic |
| DRACP01005 | Esculentin (1-21) | GIFSKLAGKKIKNLLISGLKG | 21 | Synthetic |
| DRACP01006 | Esculentin (1-21)[L14l,S17s] | GIFSKLAGKKIKNlLIsGLKG | 21 | Synthetic |
| DRACP01007 | Esculentin (1-18) | GIFSKLAGKKLKNLLISG | 18 | Synthetic |
| DRACP01008 | Granuliberin-SSa | FIFLPIFRRPVS | 12 | Glandirana susurra |
| DRACP01009 | Ranatuerin-2SSa | GLISTIWNTASNVAGTLTDSVKCKFKKC | 28 | Glandirana susurra |
| DRACP01010 | Brevinin-2SSb | SLFSLIKAGAKFLGKNMLKQGPQYPACKVSKDSENVNWKS | 40 | Glandirana susurra |
| DRACP01011 | Brevinin-1H | FALGAVTKVLPKLFCLITRKC | 21 | skin secretion of Amolops hainanensis |
| DRACP01012 | Brevinin-1Ha | FALGAVTKVLPKLFCLITRKC | 21 | skin secretion of Amolops hainanensis |
| DRACP01013 | Brevinin-1HY | FALGAVTKVLYKLFCLITRKC | 21 | skin secretion of Amolops hainanensis |
| DRACP01014 | B18K | GFQKVKAQAATCNHTVMA | 18 | Synthetic |
| DRACP01015 | B18KA | GFQKVKAQALTCLHTVMA | 18 | Synthetic |
| DRACP01016 | B18KL | GFQKVKAQALTCLHTVMA | 18 | Synthetic |
| DRACP01017 | B18I | GIGKAIAKAIACIAKAIA | 18 | Synthetic |
| DRACP01018 | B18L | GLGKALAKALACLAKALA | 18 | Synthetic |
| DRACP01019 | Temporin-SHe | FLPALAGIAGLLGKIF | 16 | Pelophylax saharicus |
| DRACP01020 | Figainin 1 | FIGTLIPLALGALTKLFK | 18 | B. raniceps skin secretion |
| DRACP01021 | C1 | CKKKC | 5 | Synthetic |
| DRACP01022 | C6 | CKKKRC | 6 | Synthetic |
| DRACP01023 | C5 | CKKRKC | 6 | Synthetic |
This work is licensed under a Creative Commons Attribution 4.0 International License.